Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3744
Gene name
LocationContig_292:1791..3568
Strand+
Gene length (bp)1777
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 4.3E-104 58 516
PF13520 AA_permease_2 Amino acid permease 6.7E-24 64 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 35 540 3.0E-99
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 49 541 2.0E-96
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 44 539 5.0E-96
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 22 537 6.0E-96
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 51 534 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 35 540 3.0E-99
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 49 541 2.0E-96
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 44 539 5.0E-96
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 22 537 6.0E-96
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 51 534 2.0E-95
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 35 530 3.0E-95
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 16 528 5.0E-93
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 3 528 5.0E-90
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 20 528 1.0E-86
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 32 510 1.0E-85
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 30 535 1.0E-85
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 20 531 1.0E-83
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 20 542 5.0E-83
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 30 537 8.0E-83
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 28 514 3.0E-82
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 6 540 4.0E-82
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 48 538 5.0E-82
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 44 510 8.0E-80
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 9 539 1.0E-79
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 16 524 7.0E-79
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 14 540 1.0E-78
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 2 540 1.0E-78
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 14 540 1.0E-78
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 45 526 2.0E-78
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 34 541 4.0E-76
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 31 540 2.0E-75
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 48 532 2.0E-74
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 38 541 1.0E-71
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 31 532 5.0E-71
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 46 539 3.0E-69
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 3 508 2.0E-67
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 2 539 1.0E-63
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 46 529 2.0E-63
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 14 540 4.0E-59
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 4 508 1.0E-57
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 44 478 7.0E-57
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 37 529 7.0E-56
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 24 477 8.0E-56
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 44 482 1.0E-53
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 44 482 1.0E-53
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 44 482 2.0E-53
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 44 454 6.0E-53
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 43 482 2.0E-52
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 43 482 2.0E-52
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 43 482 2.0E-52
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 27 514 9.0E-51
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 45 447 2.0E-50
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 44 517 2.0E-48
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 43 509 1.0E-46
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 47 388 1.0E-45
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 47 388 1.0E-45
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 49 474 4.0E-45
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 46 474 5.0E-44
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 46 474 5.0E-44
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 44 440 7.0E-44
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 46 459 2.0E-43
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 38 388 2.0E-43
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 30 447 3.0E-42
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 46 448 4.0E-42
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 37 536 2.0E-40
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 46 448 4.0E-40
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 46 448 4.0E-40
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 46 448 4.0E-40
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 43 440 7.0E-40
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 30 447 8.0E-39
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 46 388 6.0E-38
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 46 475 3.0E-36
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 46 475 3.0E-36
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 46 475 3.0E-36
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 45 459 3.0E-35
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 46 455 4.0E-35
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 46 455 4.0E-35
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 46 455 3.0E-34
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 27 454 9.0E-33
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 44 463 8.0E-32
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 44 482 4.0E-26
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 42 451 5.0E-18
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 47 202 5.0E-17
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 52 212 2.0E-15
sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3 45 322 6.0E-10
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 48 401 7.0E-10
sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=1 SV=1 43 283 2.0E-09
sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 43 283 5.0E-09
sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 46 283 6.0E-08
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 44 376 9.0E-08
sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 43 458 3.0E-07
sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 49 322 3.0E-06
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 44 389 5.0E-06
sp|B3TP03|CTR2_CHICK Cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1 49 283 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 130 152 22
4 167 189 22
5 194 216 22
6 248 270 22
7 289 311 22
8 326 348 22
9 385 407 22
10 412 434 22
11 461 483 22
12 493 510 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3744
MLRSKLDYGSTATTTPVEPEPARPDSPPATSDSPSDHDAHVVTHTESRSLRRGLAERHLSMLGIAGAIGTGLFLG
LGAAVRRAGPLGALMGYATIGLVVCAVQLALGEVAALLPVTGSFVRHSETLLDPAWGFAIGWNIVYGNVLSIPSE
MTAVCVLFRFWTDAVSPVVYIVVFMLLTLAVGLSPVRLFGQVEFLFALIKILLVVFLIILGLVIDLGGVAGTKPL
YFRYWRNPGPMVEYIAHGSWGRFLGYWSVMTGAVFSFAGVESIAMAAAETRNPRRAIPAACRNVFIRILLFYMLA
ILIVGMLVSSNDPRLDNASGDAAQSPFVIAATAAGLSAIPSLVNAVVITSAWSASNQSLLTGTRTLYGLALKRQA
PSLFLKTTSWGVPYMCVAVFALFMFLSFISLSNDALTVFWWLVDLTAAGILVSWISILLNHIRLRLAMKKQQIPL
SRLPWYNSWTIYASYAALAMCILILLTSGFAVFTTGRWSATDFVSAYLDIPLVLGAYLLWKWVKGTTIVNLSDVP
LQSALDQAHQKQVDSAC*
Coding >OphauG2|3744
ATGCTTCGCTCCAAGCTAGATTACGGCTCCACAGCCACCACGACGCCCGTCGAGCCGGAACCGGCCCGCCCCGAC
TCGCCCCCCGCCACCTCGGACTCCCCCTCGGACCATGACGCCCATGTCGTGACGCACACAGAGAGCCGCTCGCTG
CGCCGCGGGCTGGCTGAGCGCCACCTGTCCATGCTGGGAATCGCGGGCGCCATTGGCACCGGCCTCTTCCTCGGC
CTCGGCGCCGCCGTGCGAAGAGCCGGTCCGCTGGGCGCCTTGATGGGATACGCAACCATTGGCCTGGTTGTTTGC
GCCGTCCAGCTGGCTCTCGGCGAGGTTGCCGCCCTGCTGCCCGTCACCGGCTCCTTTGTGCGCCACTCCGAGACC
CTGCTCGATCCCGCCTGGGGCTTTGCCATTGGCTGGAACATCGTCTACGGCAACGTCTTGTCCATTCCGTCCGAG
ATGACGGCCGTCTGCGTGCTCTTTCGCTTCTGGACCGACGCCGTGTCGCCCGTCGTCTACATTGTCGTTTTCATG
CTGCTGACTCTTGCCGTTGGCCTCTCGCCAGTCCGCCTCTTTGGCCAAGTCGAGTTCTTGTTTGCCCTCATCAAG
ATCCTCCTCGTCGTCTTCCTCATCATCCTCGGCCTCGTCATTGACCTGGGCGGCGTTGCAGGCACCAAGCCGCTC
TACTTTCGCTACTGGCGCAACCCGGGCCCCATGGTCGAGTATATTGCCCACGGCAGCTGGGGCCGCTTCCTCGGC
TACTGGAGCGTCATGACGGGCGCCGTCTTTTCCTTTGCCGGCGTCGAGTCCATTGCCATGGCTGCTGCCGAGACG
CGGAACCCGCGCCGCGCCATCCCCGCCGCCTGCCGCAACGTCTTTATCCGCATCCTGCTCTTCTACATGCTCGCC
ATTCTCATCGTCGGCATGCTCGTCTCCAGCAACGACCCACGCCTCGACAATGCCAGCGGCGACGCCGCCCAAAGC
CCCTTTGTCATTGCCGCCACCGCTGCTGGTCTGTCCGCCATCCCGTCTCTTGTCAATGCCGTCGTCATCACCTCG
GCTTGGTCCGCCTCCAACCAGAGCCTGCTCACCGGCACCCGCACCCTCTACGGCCTGGCCCTCAAGCGTCAGGCC
CCCTCCCTTTTTCTCAAAACCACCTCATGGGGCGTGCCCTACATGTGTGTTGCTGTCTTTGCCCTCTTCATGTTT
CTCAGCTTCATAAGTCTCTCCAACGACGCCCTGACTGTCTTTTGGTGGCTCGTCGACCTGACGGCTGCCGGTATC
CTCGTCTCGTGGATCTCCATTTTGCTAAACCACATTCGCTTACGCCTCGCCATGAAGAAGCAGCAGATTCCACTC
AGCAGGCTTCCTTGGTACAATTCCTGGACTATCTACGCGTCGTATGCTGCCCTTGCCATGTGTATCTTGATCCTC
CTCACCAGCGGCTTTGCCGTCTTTACCACGGGACGCTGGAGTGCTACCGATTTCGTCTCAGCATACTTGGACATA
CCGCTCGTTCTTGGTGCATATCTCTTATGGAAATGGGTCAAGGGCACCACCATTGTAAATCTTTCCGACGTGCCT
CTCCAAAGCGCCCTTGACCAAGCACATCAGAAACAGGTAGACTCGGCTTGCTAA
Transcript >OphauG2|3744
ATGCTTCGCTCCAAGCTAGATTACGGCTCCACAGCCACCACGACGCCCGTCGAGCCGGAACCGGCCCGCCCCGAC
TCGCCCCCCGCCACCTCGGACTCCCCCTCGGACCATGACGCCCATGTCGTGACGCACACAGAGAGCCGCTCGCTG
CGCCGCGGGCTGGCTGAGCGCCACCTGTCCATGCTGGGAATCGCGGGCGCCATTGGCACCGGCCTCTTCCTCGGC
CTCGGCGCCGCCGTGCGAAGAGCCGGTCCGCTGGGCGCCTTGATGGGATACGCAACCATTGGCCTGGTTGTTTGC
GCCGTCCAGCTGGCTCTCGGCGAGGTTGCCGCCCTGCTGCCCGTCACCGGCTCCTTTGTGCGCCACTCCGAGACC
CTGCTCGATCCCGCCTGGGGCTTTGCCATTGGCTGGAACATCGTCTACGGCAACGTCTTGTCCATTCCGTCCGAG
ATGACGGCCGTCTGCGTGCTCTTTCGCTTCTGGACCGACGCCGTGTCGCCCGTCGTCTACATTGTCGTTTTCATG
CTGCTGACTCTTGCCGTTGGCCTCTCGCCAGTCCGCCTCTTTGGCCAAGTCGAGTTCTTGTTTGCCCTCATCAAG
ATCCTCCTCGTCGTCTTCCTCATCATCCTCGGCCTCGTCATTGACCTGGGCGGCGTTGCAGGCACCAAGCCGCTC
TACTTTCGCTACTGGCGCAACCCGGGCCCCATGGTCGAGTATATTGCCCACGGCAGCTGGGGCCGCTTCCTCGGC
TACTGGAGCGTCATGACGGGCGCCGTCTTTTCCTTTGCCGGCGTCGAGTCCATTGCCATGGCTGCTGCCGAGACG
CGGAACCCGCGCCGCGCCATCCCCGCCGCCTGCCGCAACGTCTTTATCCGCATCCTGCTCTTCTACATGCTCGCC
ATTCTCATCGTCGGCATGCTCGTCTCCAGCAACGACCCACGCCTCGACAATGCCAGCGGCGACGCCGCCCAAAGC
CCCTTTGTCATTGCCGCCACCGCTGCTGGTCTGTCCGCCATCCCGTCTCTTGTCAATGCCGTCGTCATCACCTCG
GCTTGGTCCGCCTCCAACCAGAGCCTGCTCACCGGCACCCGCACCCTCTACGGCCTGGCCCTCAAGCGTCAGGCC
CCCTCCCTTTTTCTCAAAACCACCTCATGGGGCGTGCCCTACATGTGTGTTGCTGTCTTTGCCCTCTTCATGTTT
CTCAGCTTCATAAGTCTCTCCAACGACGCCCTGACTGTCTTTTGGTGGCTCGTCGACCTGACGGCTGCCGGTATC
CTCGTCTCGTGGATCTCCATTTTGCTAAACCACATTCGCTTACGCCTCGCCATGAAGAAGCAGCAGATTCCACTC
AGCAGGCTTCCTTGGTACAATTCCTGGACTATCTACGCGTCGTATGCTGCCCTTGCCATGTGTATCTTGATCCTC
CTCACCAGCGGCTTTGCCGTCTTTACCACGGGACGCTGGAGTGCTACCGATTTCGTCTCAGCATACTTGGACATA
CCGCTCGTTCTTGGTGCATATCTCTTATGGAAATGGGTCAAGGGCACCACCATTGTAAATCTTTCCGACGTGCCT
CTCCAAAGCGCCCTTGACCAAGCACATCAGAAACAGGTAGACTCGGCTTGCTAA
Gene >OphauG2|3744
ATGCTTCGCTCCAAGCTAGATTACGGCTCCACAGCCACCACGACGCCCGTCGAGCCGGAACCGGCCCGCCCCGAC
TCGCCCCCCGCCACCTCGGACTCCCCCTCGGACCATGACGCCCATGTCGTGACGCACACAGAGAGCCGCTCGCTG
CGCCGCGGGCTGGCTGAGCGCCACCTGTCCATGCTGGGAATCGCGGGCGCCATTGGCACCGGCCTCTTCCTCGGC
CTCGGCGCCGCCGTGCGAAGAGCCGGTCCGCTGGGCGCCTTGATGGGATACGCAACCATTGGCCTGGTTGTTTGC
GCCGTCCAGCTGGCTCTCGGCGAGGTTGCCGCCCTGCTGCCCGTCACCGGCTCCTTTGTGCGCCACTCCGAGACC
CTGCTCGATCCCGCCTGGGGCTTTGCCATTGGCTGGAACATCGTCTACGGCAACGTCTTGTCCATTCCGTCCGAG
ATGACGGCCGTCTGCGTGCTCTTTCGCTTCTGGACCGACGCCGTGTCGCCCGTCGTCTACATTGTCGTTTTCATG
CTGCTGACTCTTGCCGTTGGCCTCTCGCCAGTCCGCCTCTTTGGCCAAGTCGAGTTCTTGTTTGCCCTCATCAAG
ATCCTCCTCGTCGTCTTCCTCATCATCCTCGGCCTCGTCATTGACCTGGGCGGCGTTGCAGGCACCAAGCCGCTC
TACTTTCGCTACTGGCGCAACCCGGGCCCCATGGTCGAGTATATTGCCCACGGCAGCTGGGGCCGCTTCCTCGGC
TACTGGAGCGTCATGACGGGCGCCGTCTTTTCCTTTGCCGGCGTCGAGTCCATTGCCATGGCTGCTGCCGAGACG
CGGAACCCGCGCCGCGCCATCCCCGCCGCCTGCCGCAACGTCTTTATCCGCATCCTGCTCTTCTACATGCTCGCC
ATTCTCATCGTCGGCATGCTCGTCTCCAGCAACGACCCACGCCTCGACAATGCCAGCGGCGACGCCGCCCAAAGC
CCCTTTGTCATTGCCGCCACCGCTGCTGGTCTGTCCGCCATCCCGTCTCTTGTCAATGCCGTCGTCATCACCTCG
GCTTGGTCCGCCTCCAACCAGAGCCTGCTCACCGGCACCCGCACCCTCTACGGCCTGGCCCTCAAGCGTCAGGCC
CCCTCCCTTTTTCTCAAAACCACCTCATGGGGCGTGCCCTACATGTGTGTTGCTGTCTTTGCCCTCTTCATGTTT
CTCAGCTTCATAAGTCTCTCCAACGACGCCCTGACTGTCTTTTGGTGGCTCGTCGACCTGACGGCTGCCGGTATC
CTCGTCTCGTGGATCTCCATTTTGCTAAACCACATTCGCTTACGCCTCGCCATGAAGAAGCAGCAGATTCCACTC
AGCAGGCTTCCTTGGTACAATTCCTGGACTAGTGCGTCTCGGCCCTTAATTTCCACTCCATTTCTGTTAGCCTTT
CTCCTCCCCCCCTGCGCTAATCCCCCTCACAGTCTACGCGTCGTATGCTGCCCTTGCCATGTGTATCTTGATCCT
CCTCACCAGCGGCTTTGCCGTCTTTACCACGGGACGCTGGAGTGCTACCGATTTCGTCTCAGCATACTTGTACGA
GCCTTTCTTGGGAAAACCTCCCCCAGTTTCCCCCTCGTGCTTGCCATTGACTCTTGAGCTCGTTAGGGACATACC
GCTCGTTCTTGGTGCATATCTCTTATGGAAATGGGTCAAGGGCACCACCATTGTAAATCTTTCCGACGTGCCTCT
CCAAAGCGCCCTTGACCAAGCACATCAGAAACAGGTAGACTCGGCTTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail