Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3739
Gene name
LocationContig_291:5228..6480
Strand-
Gene length (bp)1252
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 2.4E-72 20 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 69 344 8.0E-26
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 69 352 2.0E-25
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 20 370 6.0E-24
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 74 352 1.0E-21
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 78 358 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 69 344 8.0E-26
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 69 352 2.0E-25
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 20 370 6.0E-24
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 74 352 1.0E-21
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 78 358 2.0E-21
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 78 358 2.0E-21
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 69 352 2.0E-20
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 69 352 2.0E-20
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 74 352 4.0E-20
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 74 352 4.0E-20
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 8 349 6.0E-20
sp|P0CB51|CHI1_COCPS Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CTS1 PE=1 SV=1 74 352 1.0E-19
sp|Q1E3R8|CHI1_COCIM Endochitinase 1 OS=Coccidioides immitis (strain RS) GN=CTS1 PE=3 SV=1 74 352 1.0E-19
sp|C5P230|CHI1_COCP7 Endochitinase 1 OS=Coccidioides posadasii (strain C735) GN=CTS1 PE=3 SV=1 74 352 2.0E-19
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 78 351 4.0E-19
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 68 349 6.0E-19
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 68 349 8.0E-18
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 75 349 9.0E-17
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 64 344 2.0E-14
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 79 351 2.0E-14
sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 78 349 3.0E-14
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 78 349 6.0E-14
sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 78 261 7.0E-14
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 78 261 3.0E-13
sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 78 349 4.0E-13
sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 78 261 5.0E-13
sp|Q9W092|CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster GN=Cht2 PE=1 SV=1 78 249 6.0E-13
sp|Q91Z98|CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus GN=Chil4 PE=1 SV=2 78 262 8.0E-13
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 74 312 1.0E-12
sp|O35744|CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus GN=Chil3 PE=1 SV=2 78 280 2.0E-12
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 74 349 2.0E-12
sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 78 349 3.0E-12
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 70 262 9.0E-12
sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 78 261 2.0E-11
sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=1 SV=3 78 349 2.0E-11
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 77 247 2.0E-11
sp|Q15782|CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens GN=CHI3L2 PE=1 SV=1 78 349 9.0E-11
sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=3 78 260 9.0E-11
sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 19 257 2.0E-10
sp|P11797|CHIB_SERMA Chitinase B OS=Serratia marcescens GN=chiB PE=1 SV=1 78 365 2.0E-10
sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 78 261 2.0E-10
sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 78 260 2.0E-10
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 32 349 1.0E-09
sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 78 260 1.0E-09
sp|P32823|CHIA_PSEO7 Chitinase A OS=Pseudoalteromonas piscicida GN=chiA PE=1 SV=1 78 363 5.0E-09
sp|H2A0L5|CHI2_PINMG Putative chitinase 2 OS=Pinctada margaritifera PE=1 SV=1 63 351 2.0E-08
sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 74 257 3.0E-08
sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 74 257 4.0E-08
sp|Q62010|OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus GN=Ovgp1 PE=2 SV=1 74 280 7.0E-08
sp|P86955|CHI_PINMA Putative chitinase OS=Pinctada maxima PE=1 SV=1 63 351 1.0E-07
sp|Q2PQM7|IDGF4_GLOMM Chitinase-like protein Idgf4 OS=Glossina morsitans morsitans GN=Idgf4 PE=2 SV=1 78 337 9.0E-07
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 78 364 1.0E-06
sp|P96156|CHID_VIBFU Chitodextrinase OS=Vibrio furnissii GN=endo I PE=1 SV=1 76 248 1.0E-06
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 68 350 2.0E-06
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 82 345 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3739
MRSWALGLMATAVSAATPRYLIYFDQWHTESLPSREETAGINYITTAFAKSETFNTGTDYKPFMPVAQVRELFDK
GAKVCMAIGGWGDTQGFGTAAATHESRKTFAKNVATTLDNLGYDCVDIDWEYPGGNGEDYKQITNDKKTSEIESY
PQLLSEIKAAIGTKELSIATPGREADFIAYTAEQVPKISEAVDFVNVMAYDLMNRRDNQTLHMSGVQDSKKTIQL
YLDRGMPASKINLGLPFYAKFFQTQGECKQAMGCPTVEMEDANGKDLGKSGAVTFSKAEASDAGLKQALAKGKLD
AEQGGMWWWDPATKNFWTWDSPELMKRKVEEIVKPMGLGGIFAWSLGLDSNGYAHVKAMREGFQSMSKTPMC*
Coding >OphauG2|3739
ATGCGGTCTTGGGCGCTTGGACTCATGGCCACGGCTGTCTCAGCAGCCACGCCGAGATATCTTATTTATTTTGAC
CAATGGCACACCGAGTCTCTGCCCAGCAGGGAGGAGACGGCGGGCATCAACTACATCACGACAGCGTTTGCCAAG
TCTGAAACTTTCAACACGGGCACAGACTACAAGCCGTTTATGCCTGTTGCCCAAGTGCGCGAGCTCTTTGACAAG
GGCGCCAAGGTGTGCATGGCGATTGGCGGCTGGGGAGACACTCAGGGCTTTGGCACAGCGGCCGCGACGCACGAG
TCGCGCAAGACATTTGCCAAAAATGTGGCGACGACGCTGGACAATCTGGGCTATGACTGCGTGGACATTGATTGG
GAGTACCCTGGCGGCAACGGCGAGGACTACAAGCAAATCACAAACGACAAAAAGACGAGCGAGATTGAAAGTTAT
CCGCAGCTGCTGTCTGAGATCAAGGCGGCCATTGGCACCAAGGAACTGTCCATTGCAACGCCGGGGCGGGAAGCC
GACTTTATTGCATATACGGCTGAGCAGGTGCCCAAGATTAGCGAGGCTGTCGACTTTGTCAATGTCATGGCTTAC
GACTTGATGAACCGCCGCGATAACCAAACCCTCCACATGTCGGGCGTCCAAGACTCCAAGAAAACCATCCAGCTC
TACCTTGACCGCGGCATGCCGGCGTCCAAGATCAATCTCGGGCTCCCGTTTTACGCAAAGTTCTTCCAAACTCAG
GGCGAGTGCAAACAAGCCATGGGCTGCCCAACCGTCGAGATGGAAGACGCAAACGGCAAGGATCTGGGCAAGTCG
GGAGCCGTCACGTTTTCCAAGGCCGAGGCGTCGGACGCGGGTCTCAAGCAGGCGCTGGCAAAGGGAAAGCTGGAT
GCCGAGCAGGGCGGCATGTGGTGGTGGGATCCGGCCACCAAGAACTTTTGGACGTGGGACTCGCCCGAGCTGATG
AAGCGCAAGGTTGAAGAGATTGTCAAGCCCATGGGGCTGGGAGGCATCTTTGCGTGGTCATTGGGGCTGGATAGC
AACGGCTATGCGCACGTCAAGGCGATGCGAGAGGGCTTTCAGTCCATGAGCAAGACGCCTATGTGCTAG
Transcript >OphauG2|3739
ATGCGGTCTTGGGCGCTTGGACTCATGGCCACGGCTGTCTCAGCAGCCACGCCGAGATATCTTATTTATTTTGAC
CAATGGCACACCGAGTCTCTGCCCAGCAGGGAGGAGACGGCGGGCATCAACTACATCACGACAGCGTTTGCCAAG
TCTGAAACTTTCAACACGGGCACAGACTACAAGCCGTTTATGCCTGTTGCCCAAGTGCGCGAGCTCTTTGACAAG
GGCGCCAAGGTGTGCATGGCGATTGGCGGCTGGGGAGACACTCAGGGCTTTGGCACAGCGGCCGCGACGCACGAG
TCGCGCAAGACATTTGCCAAAAATGTGGCGACGACGCTGGACAATCTGGGCTATGACTGCGTGGACATTGATTGG
GAGTACCCTGGCGGCAACGGCGAGGACTACAAGCAAATCACAAACGACAAAAAGACGAGCGAGATTGAAAGTTAT
CCGCAGCTGCTGTCTGAGATCAAGGCGGCCATTGGCACCAAGGAACTGTCCATTGCAACGCCGGGGCGGGAAGCC
GACTTTATTGCATATACGGCTGAGCAGGTGCCCAAGATTAGCGAGGCTGTCGACTTTGTCAATGTCATGGCTTAC
GACTTGATGAACCGCCGCGATAACCAAACCCTCCACATGTCGGGCGTCCAAGACTCCAAGAAAACCATCCAGCTC
TACCTTGACCGCGGCATGCCGGCGTCCAAGATCAATCTCGGGCTCCCGTTTTACGCAAAGTTCTTCCAAACTCAG
GGCGAGTGCAAACAAGCCATGGGCTGCCCAACCGTCGAGATGGAAGACGCAAACGGCAAGGATCTGGGCAAGTCG
GGAGCCGTCACGTTTTCCAAGGCCGAGGCGTCGGACGCGGGTCTCAAGCAGGCGCTGGCAAAGGGAAAGCTGGAT
GCCGAGCAGGGCGGCATGTGGTGGTGGGATCCGGCCACCAAGAACTTTTGGACGTGGGACTCGCCCGAGCTGATG
AAGCGCAAGGTTGAAGAGATTGTCAAGCCCATGGGGCTGGGAGGCATCTTTGCGTGGTCATTGGGGCTGGATAGC
AACGGCTATGCGCACGTCAAGGCGATGCGAGAGGGCTTTCAGTCCATGAGCAAGACGCCTATGTGCTAG
Gene >OphauG2|3739
ATGCGGTCTTGGGCGCTTGGACTCATGGCCACGGCTGTCTCAGCAGCCACGCCGAGATATCTTATTTATTTTGAC
CAGTAGGTTGACAAGGCCTTGGATTGCTCGTGGCTGACAAGAGCGGCAGATGGCACACCGAGTCTCTGCCCAGCA
GGGAGGAGACGGCGGGCATCAACTACATCACGACAGCGTTTGCCAAGTCTGAAACTTTCAACACGGGCACAGACT
ACAAGCCGTTTATGCCTGTTGCCCAAGTGCGCGAGCTCTTTGACAAGGGCGCCAAGGTGTGCATGGCGATTGGCG
GCTGGGGAGACACTCAGGGCTTTGGCACAGCGGCCGCGACGCACGAGTCGCGCAAGACATTTGCCAAAAATGTGG
CGACGACGCTGGACAATCTGGGCTATGACTGCGTGGACATTGATTGGGAGTACCCTGGCGGCAACGGCGAGGACT
ACAAGCAAATCACAAACGACAAAAAGACGAGCGAGATTGAAAGTTATCCGCAGCTGCTGTCTGAGATCAAGGCGG
CCATTGGCACCAAGGAACTGTCCATTGCAACGCCGGGGCGGGAAGCCGACTTTATTGCATATACGGCTGAGCAGG
TGCCCAAGATTAGCGAGGCTGTCGACTTTGTCAATGTGAGTGGTCAAGGGGCAGCTTTTGAGGATTCTGAGAGAT
GCGACAGGCAAAAAAGAGGAGCAAAAGCGCTGACTGTTTGGGCCAGGTCATGGCTTACGACTTGATGAACCGCCG
CGATAACCAAACCCTCCACATGTCGGGCGTCCAAGACTCCAAGAAAACCATCCAGCTCTACCTTGACCGCGGCAT
GCCGGCGTCCAAGATCAATCTCGGGCTCCCGTTTTACGCAAAGTTCTTCCAAACTCAGGGCGAGTGCAAACAAGC
CATGGGCTGCCCAACCGTCGAGATGGAAGACGCAAACGGCAAGGATCTGGGCAAGTCGGGAGCCGTCACGTTTTC
CAAGGCCGAGGCGTCGGACGCGGGTCTCAAGCAGGCGCTGGCAAAGGGAAAGCTGGATGCCGAGCAGGGCGGCAT
GTGGTGGTGGGATCCGGCCACCAAGAACTTTTGGACGTGGGACTCGCCCGAGCTGATGAAGCGCAAGGTTGAAGA
GATTGTCAAGCCCATGGGGCTGGGAGGCATCTTTGCGTGGTCATTGGGGCTGGATAGCAACGGCTATGCGCACGT
CAAGGCGATGCGAGAGGGCTTTCAGTCCATGAGCAAGACGCCTATGTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail