Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3738
Gene name
LocationContig_291:3838..4810
Strand-
Gene length (bp)972
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01138 RNase_PH 3' exoribonuclease family, domain 1 5.9E-24 32 164
PF03725 RNase_PH_C 3' exoribonuclease family, domain 2 3.2E-10 190 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74918|RRP45_SCHPO Exosome complex component rrp45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp45 PE=3 SV=1 1 293 2.0E-101
sp|Q05636|RRP45_YEAST Exosome complex component RRP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP45 PE=1 SV=1 1 293 9.0E-88
sp|Q9LDM2|CER7L_ARATH Exosome complex component RRP45A OS=Arabidopsis thaliana GN=RRP45A PE=2 SV=1 8 277 2.0E-65
sp|Q4QR75|EXOS9_RAT Exosome complex component RRP45 OS=Rattus norvegicus GN=Exosc9 PE=1 SV=1 3 282 4.0E-65
sp|Q9JHI7|EXOS9_MOUSE Exosome complex component RRP45 OS=Mus musculus GN=Exosc9 PE=1 SV=1 3 282 4.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74918|RRP45_SCHPO Exosome complex component rrp45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp45 PE=3 SV=1 1 293 2.0E-101
sp|Q05636|RRP45_YEAST Exosome complex component RRP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP45 PE=1 SV=1 1 293 9.0E-88
sp|Q9LDM2|CER7L_ARATH Exosome complex component RRP45A OS=Arabidopsis thaliana GN=RRP45A PE=2 SV=1 8 277 2.0E-65
sp|Q4QR75|EXOS9_RAT Exosome complex component RRP45 OS=Rattus norvegicus GN=Exosc9 PE=1 SV=1 3 282 4.0E-65
sp|Q9JHI7|EXOS9_MOUSE Exosome complex component RRP45 OS=Mus musculus GN=Exosc9 PE=1 SV=1 3 282 4.0E-65
sp|Q06265|EXOS9_HUMAN Exosome complex component RRP45 OS=Homo sapiens GN=EXOSC9 PE=1 SV=3 3 282 5.0E-64
sp|Q9M209|CER7_ARATH Exosome complex component RRP45B OS=Arabidopsis thaliana GN=RRP45B PE=2 SV=1 8 271 1.0E-63
sp|Q3SWZ4|EXOS9_BOVIN Exosome complex component RRP45 OS=Bos taurus GN=EXOSC9 PE=2 SV=1 3 282 1.0E-63
sp|Q8TYC2|RRP42_METKA Exosome complex component Rrp42 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rrp42 PE=3 SV=1 15 271 2.0E-37
sp|Q8U0M0|RRP42_PYRFU Exosome complex component Rrp42 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rrp42 PE=3 SV=1 12 267 8.0E-36
sp|Q5JIR7|RRP42_THEKO Exosome complex component Rrp42 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rrp42 PE=3 SV=1 12 238 9.0E-36
sp|C5A2B8|RRP42_THEGJ Exosome complex component Rrp42 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rrp42 PE=3 SV=1 12 260 4.0E-35
sp|B6YSE7|RRP42_THEON Exosome complex component Rrp42 OS=Thermococcus onnurineus (strain NA1) GN=rrp42 PE=3 SV=1 12 241 5.0E-35
sp|O59224|RRP42_PYRHO Exosome complex component Rrp42 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rrp42 PE=3 SV=1 12 267 2.0E-33
sp|Q0W2Y7|RRP42_METAR Exosome complex component Rrp42 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rrp42 PE=3 SV=1 11 240 7.0E-33
sp|Q8TGX5|RRP42_METAC Exosome complex component Rrp42 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rrp42 PE=3 SV=1 11 260 2.0E-31
sp|O26778|RRP42_METTH Exosome complex component Rrp42 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rrp42 PE=1 SV=1 24 242 3.0E-31
sp|Q9V118|RRP42_PYRAB Exosome complex component Rrp42 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rrp42 PE=1 SV=1 12 260 4.0E-31
sp|Q8PTT7|RRP42_METMA Exosome complex component Rrp42 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rrp42 PE=3 SV=1 11 260 1.0E-30
sp|Q2KHU3|EXOS8_BOVIN Exosome complex component RRP43 OS=Bos taurus GN=EXOSC8 PE=2 SV=1 13 268 2.0E-30
sp|Q9HIP1|RRP42_THEAC Exosome complex component Rrp42 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rrp42 PE=3 SV=2 1 238 5.0E-30
sp|Q975G9|RRP42_SULTO Exosome complex component Rrp42 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rrp42 PE=3 SV=1 8 238 7.0E-30
sp|Q96B26|EXOS8_HUMAN Exosome complex component RRP43 OS=Homo sapiens GN=EXOSC8 PE=1 SV=1 13 268 6.0E-29
sp|Q97BZ4|RRP42_THEVO Exosome complex component Rrp42 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rrp42 PE=3 SV=1 1 238 8.0E-29
sp|Q9D753|EXOS8_MOUSE Exosome complex component RRP43 OS=Mus musculus GN=Exosc8 PE=1 SV=1 13 278 1.0E-28
sp|Q10205|RRP43_SCHPO Exosome complex component rrp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp43 PE=3 SV=1 7 256 8.0E-26
sp|Q9YC05|RRP42_AERPE Exosome complex component Rrp42 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rrp42 PE=3 SV=1 12 173 4.0E-25
sp|Q8ZVN0|RRP42_PYRAE Exosome complex component Rrp42 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rrp42 PE=3 SV=1 8 240 4.0E-25
sp|Q9UXC0|RRP42_SULSO Exosome complex component Rrp42 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rrp42 PE=1 SV=1 9 245 6.0E-24
sp|C3MVG5|RRP42_SULIM Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rrp42 PE=3 SV=1 9 245 3.0E-23
sp|C3N5R4|RRP42_SULIA Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain M.16.27) GN=rrp42 PE=3 SV=1 9 245 3.0E-23
sp|C3NED0|RRP42_SULIY Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rrp42 PE=3 SV=1 9 245 4.0E-23
sp|C3MQ47|RRP42_SULIL Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rrp42 PE=3 SV=1 9 245 4.0E-23
sp|C4KHE3|RRP42_SULIK Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rrp42 PE=3 SV=1 9 245 4.0E-23
sp|C3NHC2|RRP42_SULIN Exosome complex component Rrp42 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rrp42 PE=3 SV=1 9 245 4.0E-23
sp|O29756|RRP42_ARCFU Exosome complex component Rrp42 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rrp42 PE=1 SV=1 11 261 3.0E-22
sp|Q15024|EXOS7_HUMAN Exosome complex component RRP42 OS=Homo sapiens GN=EXOSC7 PE=1 SV=3 8 283 2.0E-18
sp|Q9D0M0|EXOS7_MOUSE Exosome complex exonuclease RRP42 OS=Mus musculus GN=Exosc7 PE=1 SV=2 8 266 3.0E-17
sp|Q54VM4|EXOS7_DICDI Putative exosome complex exonuclease RRP42 OS=Dictyostelium discoideum GN=exosc7 PE=3 SV=1 10 273 1.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3738
MPREAEPSLAEKEFVCKALGEGLRLDGRSLDEFRPLQLSFGDEYGVASVRCGKTSIVAKVSAEVTVPYADRPFDG
IFTITSELSPMVAPSFEVNRPTETEMLLSRLLEKTIRRSGALDTESLCLIAATKCWSVRADLHVLSHDGNLLDTS
CLALVAALRHFRKPDTTISGEVLTVYTPAEREPVPLSWLHSPFCVTFSFFGHDGDSVLLDTTLLEEQLRLGSCTF
SLNKHGDLCQVSKLGGQDIDAPILVQCAQTALDRARVFTHVVDAELAQDAKRRDKGGLMAELRAENER*
Coding >OphauG2|3738
ATGCCGCGTGAAGCCGAGCCGTCGCTCGCCGAAAAGGAATTCGTCTGCAAGGCCCTGGGCGAGGGCCTTCGTCTC
GACGGTCGCAGCCTGGACGAGTTTCGCCCCTTGCAATTGAGCTTTGGCGACGAGTATGGAGTTGCCAGTGTGCGA
TGCGGCAAAACAAGCATCGTGGCCAAAGTGTCGGCCGAGGTGACGGTGCCGTACGCCGATCGCCCCTTTGACGGC
ATCTTCACCATCACGTCTGAGCTCAGCCCCATGGTGGCGCCTTCATTCGAAGTCAACCGCCCGACAGAGACAGAG
ATGCTCCTCTCGCGTCTGCTGGAAAAGACGATCCGCCGCTCGGGCGCCCTCGACACCGAGTCGCTGTGCCTCATT
GCCGCCACCAAGTGCTGGTCCGTCCGCGCCGACCTCCATGTGCTGAGCCACGACGGCAACCTCCTCGACACGTCG
TGTCTGGCGCTCGTGGCGGCGCTGCGCCATTTCCGCAAGCCCGACACCACCATCAGCGGCGAGGTGCTGACCGTC
TATACGCCCGCCGAGCGCGAGCCCGTGCCCCTGAGCTGGCTGCACTCGCCCTTTTGCGTCACCTTTAGCTTCTTT
GGCCATGATGGCGACAGCGTGCTGCTTGACACCACGCTGCTCGAGGAGCAACTCAGGCTTGGCAGCTGTACCTTT
AGCCTCAACAAGCACGGCGACCTTTGCCAGGTGTCCAAGCTGGGCGGCCAAGACATTGATGCACCCATTTTGGTT
CAGTGCGCGCAAACGGCCCTCGACCGTGCCAGGGTATTTACACATGTCGTTGATGCCGAGCTGGCCCAAGACGCC
AAGCGCAGAGACAAGGGTGGACTCATGGCAGAGCTGAGGGCAGAAAACGAAAGATGA
Transcript >OphauG2|3738
ATGCCGCGTGAAGCCGAGCCGTCGCTCGCCGAAAAGGAATTCGTCTGCAAGGCCCTGGGCGAGGGCCTTCGTCTC
GACGGTCGCAGCCTGGACGAGTTTCGCCCCTTGCAATTGAGCTTTGGCGACGAGTATGGAGTTGCCAGTGTGCGA
TGCGGCAAAACAAGCATCGTGGCCAAAGTGTCGGCCGAGGTGACGGTGCCGTACGCCGATCGCCCCTTTGACGGC
ATCTTCACCATCACGTCTGAGCTCAGCCCCATGGTGGCGCCTTCATTCGAAGTCAACCGCCCGACAGAGACAGAG
ATGCTCCTCTCGCGTCTGCTGGAAAAGACGATCCGCCGCTCGGGCGCCCTCGACACCGAGTCGCTGTGCCTCATT
GCCGCCACCAAGTGCTGGTCCGTCCGCGCCGACCTCCATGTGCTGAGCCACGACGGCAACCTCCTCGACACGTCG
TGTCTGGCGCTCGTGGCGGCGCTGCGCCATTTCCGCAAGCCCGACACCACCATCAGCGGCGAGGTGCTGACCGTC
TATACGCCCGCCGAGCGCGAGCCCGTGCCCCTGAGCTGGCTGCACTCGCCCTTTTGCGTCACCTTTAGCTTCTTT
GGCCATGATGGCGACAGCGTGCTGCTTGACACCACGCTGCTCGAGGAGCAACTCAGGCTTGGCAGCTGTACCTTT
AGCCTCAACAAGCACGGCGACCTTTGCCAGGTGTCCAAGCTGGGCGGCCAAGACATTGATGCACCCATTTTGGTT
CAGTGCGCGCAAACGGCCCTCGACCGTGCCAGGGTATTTACACATGTCGTTGATGCCGAGCTGGCCCAAGACGCC
AAGCGCAGAGACAAGGGTGGACTCATGGCAGAGCTGAGGGCAGAAAACGAAAGATGA
Gene >OphauG2|3738
ATGCCGCGTGAAGCCGAGCCGTCGCTCGCCGAAAAGGAATTCGTCTGCAAGGCCCTGGGCGAGGGCCTTCGTCTC
GACGGTCGCAGCCTGGACGAGTTTCGCCCCTTGCAATTGAGCTTTGGCGACGAGTATGGAGTTGCCAGTGTGCGA
TGCGGCAAAACAAGGTGCCATGATGTTTTATTCTTCTCGGTCCCTTGCTCATTTCATTTCACCACCTGCTTTGAT
GCATTTTGAGCTAATGCCCAAGTCGCCAGCATCGTGGCCAAAGTGTCGGCCGAGGTGACGGTGCCGTACGCCGAT
CGCCCCTTTGACGGCATCTTCACCATCACGTCTGAGCTCAGCCCCATGGTGGCGCCTTCATTCGAAGTCAACCGC
CCGACAGAGACAGAGATGCTCCTCTCGCGTCTGCTGGAAAAGACGATCCGCCGCTCGGGCGCCCTCGACACCGAG
TCGCTGTGCCTCATTGCCGCCACCAAGTGCTGGTCCGTCCGCGCCGACCTCCATGTGCTGAGCCACGACGGCAAC
CTCCTCGACACGTCGTGTCTGGCGCTCGTGGCGGCGCTGCGCCATTTCCGCAAGCCCGACACCACCATCAGCGGC
GAGGTGCTGACCGTCTATACGCCCGCCGAGCGCGAGCCCGTGCCCCTGAGCTGGCTGCACTCGCCCTTTTGCGTC
ACCTTTAGCTTCTTTGGCCATGATGGCGACAGCGTGCTGCTTGACACCACGCTGCTCGAGGAGCAACTCAGGCTT
GGCAGCTGTACCTTTAGCCTCAACAAGCACGGCGACCTTTGCCAGGTGTCCAAGCTGGGCGGCCAAGACATTGAT
GCACCCATTTTGGTTCAGTGCGCGCAAACGGCCCTCGACCGTGCCAGGGTATTTACACATGTCGTTGATGCCGAG
CTGGCCCAAGACGCCAAGCGCAGAGACAAGGGTGGACTCATGGCAGAGCTGAGGGCAGAAAACGAAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail