Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3733
Gene name
LocationContig_290:9503..10506
Strand+
Gene length (bp)1003
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07572 BCNT Bucentaur or craniofacial development 1.9E-23 241 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I650|SWC5_GIBZE SWR1-complex protein 5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWC5 PE=3 SV=1 1 315 2.0E-106
sp|Q7RYI3|SWC5_NEUCR SWR1-complex protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crc-2 PE=3 SV=1 15 295 2.0E-73
sp|Q4WRE2|SWC5_ASPFU SWR1-complex protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swc5 PE=3 SV=1 9 313 3.0E-49
sp|Q5BER4|SWC5_EMENI SWR1-complex protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swc5 PE=3 SV=1 107 313 4.0E-31
sp|Q754T8|SWC5_ASHGO SWR1-complex protein 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWC5 PE=3 SV=1 11 310 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I650|SWC5_GIBZE SWR1-complex protein 5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWC5 PE=3 SV=1 1 315 2.0E-106
sp|Q7RYI3|SWC5_NEUCR SWR1-complex protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crc-2 PE=3 SV=1 15 295 2.0E-73
sp|Q4WRE2|SWC5_ASPFU SWR1-complex protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swc5 PE=3 SV=1 9 313 3.0E-49
sp|Q5BER4|SWC5_EMENI SWR1-complex protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swc5 PE=3 SV=1 107 313 4.0E-31
sp|Q754T8|SWC5_ASHGO SWR1-complex protein 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWC5 PE=3 SV=1 11 310 5.0E-19
sp|Q5A8H7|SWC5_CANAL SWR1-complex protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWC5 PE=3 SV=1 90 310 3.0E-18
sp|Q6CKH1|SWC5_KLULA SWR1-complex protein 5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWC5 PE=3 SV=1 93 310 1.0E-14
sp|Q6FML0|SWC5_CANGA SWR1-complex protein 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWC5 PE=3 SV=1 93 314 2.0E-14
sp|Q6BWZ7|SWC5_DEBHA SWR1-complex protein 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWC5 PE=3 SV=2 94 310 1.0E-13
sp|P38326|SWC5_YEAST SWR1-complex protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWC5 PE=1 SV=1 93 297 2.0E-13
sp|Q4ADK4|CFDP1_MUNRE Craniofacial development protein 1 OS=Muntiacus reevesi GN=CFDP1 PE=2 SV=1 122 308 1.0E-09
sp|Q8HXY9|CFDP1_BOVIN Craniofacial development protein 1 OS=Bos taurus GN=CFDP1 PE=2 SV=1 122 308 1.0E-09
sp|Q75UQ2|CFDP1_RAT Craniofacial development protein 1 OS=Rattus norvegicus GN=Cfdp1 PE=1 SV=1 167 308 2.0E-09
sp|O88271|CFDP1_MOUSE Craniofacial development protein 1 OS=Mus musculus GN=Cfdp1 PE=1 SV=1 122 308 9.0E-09
sp|Q75QI0|CFDP1_CHICK Craniofacial development protein 1 OS=Gallus gallus GN=CFDP1 PE=2 SV=1 123 308 2.0E-08
sp|Q9UEE9|CFDP1_HUMAN Craniofacial development protein 1 OS=Homo sapiens GN=CFDP1 PE=1 SV=1 165 308 3.0E-08
sp|Q4ADK7|CFDP1_CAMDR Craniofacial development protein 1 OS=Camelus dromedarius GN=CFDP1 PE=2 SV=1 165 308 3.0E-08
sp|Q60FC2|CFDP1_TRAJA Craniofacial development protein 1 OS=Tragulus javanicus GN=CFDP1 PE=2 SV=1 165 308 8.0E-08
sp|O74897|SWC5_SCHPO SWR1-complex protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swc5 PE=3 SV=1 244 310 3.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1363
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3733 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4177
Ophiocordyceps camponoti-floridani Ophcf2|04924
Ophiocordyceps camponoti-rufipedis Ophun1|5624
Ophiocordyceps kimflemingae Ophio5|2981
Ophiocordyceps subramaniannii Hirsu2|10786

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3733
MPSDLIENDNDHDQYISSEDSDFAPDDTHEQASTQSDSDKEAPEPSNKQRLKGDNQGYDNSGDETIIKKGHKRRK
RAQQKGETSDGQDGSPSGLIKTRRQRAHERAERHHLVHNGPVAVDVDALWQQMISGQPRSPGSNKVSVTNKGTNA
AIEHQVAEPKFDAPDTVHIKRTFNFAGRIHTEEKVVARDSAEAKLFLASQATDTSAQTSPAKRATKKAFRSRFEP
VIDDGSGRTDLDLSLAARTNAAKEAQAQKLNTVEKSRMDWAGYVDKEGIKDELQLASKAKDSYNSREDFLARSEA
VRQEEVRRARMAGRT*
Coding >OphauG2|3733
ATGCCTTCAGACCTCATCGAAAACGACAATGATCACGACCAGTACATATCCTCTGAGGACTCGGACTTCGCCCCA
GATGACACACACGAGCAGGCTTCCACACAGTCCGACTCTGACAAGGAGGCTCCTGAGCCGTCAAACAAGCAACGG
CTGAAAGGCGACAACCAAGGCTACGACAACTCGGGTGACGAGACGATAATCAAGAAAGGCCATAAACGGCGAAAA
CGCGCACAACAAAAGGGAGAGACGTCGGATGGCCAAGACGGCAGCCCTAGTGGCCTGATCAAAACCAGAAGGCAA
CGCGCCCACGAAAGAGCTGAACGCCATCACTTGGTTCACAATGGACCTGTGGCCGTCGACGTTGATGCGCTATGG
CAGCAAATGATATCTGGCCAGCCAAGAAGCCCAGGTTCGAACAAAGTGTCAGTGACAAACAAAGGAACCAATGCT
GCAATAGAGCATCAGGTGGCAGAACCCAAGTTCGATGCGCCCGATACCGTCCACATCAAGCGCACTTTCAACTTT
GCAGGACGTATTCACACTGAAGAAAAGGTCGTTGCTCGAGATTCGGCCGAAGCAAAGCTCTTCCTCGCCTCACAG
GCCACAGACACCTCGGCGCAAACATCACCTGCAAAGAGGGCTACTAAGAAGGCATTTCGCTCACGATTTGAACCC
GTCATTGATGATGGCTCAGGCCGCACAGATCTCGATCTCAGCCTGGCGGCGCGGACAAATGCGGCCAAGGAGGCA
CAAGCCCAGAAGCTCAACACGGTAGAGAAGAGTCGCATGGACTGGGCGGGCTATGTTGACAAAGAAGGAATCAAG
GACGAGCTCCAGTTGGCCAGCAAGGCAAAAGATTCATATAATTCCAGAGAGGATTTTCTGGCCCGCAGCGAGGCC
GTGCGCCAAGAGGAGGTAAGAAGAGCCCGAATGGCCGGACGAACGTGA
Transcript >OphauG2|3733
ATGCCTTCAGACCTCATCGAAAACGACAATGATCACGACCAGTACATATCCTCTGAGGACTCGGACTTCGCCCCA
GATGACACACACGAGCAGGCTTCCACACAGTCCGACTCTGACAAGGAGGCTCCTGAGCCGTCAAACAAGCAACGG
CTGAAAGGCGACAACCAAGGCTACGACAACTCGGGTGACGAGACGATAATCAAGAAAGGCCATAAACGGCGAAAA
CGCGCACAACAAAAGGGAGAGACGTCGGATGGCCAAGACGGCAGCCCTAGTGGCCTGATCAAAACCAGAAGGCAA
CGCGCCCACGAAAGAGCTGAACGCCATCACTTGGTTCACAATGGACCTGTGGCCGTCGACGTTGATGCGCTATGG
CAGCAAATGATATCTGGCCAGCCAAGAAGCCCAGGTTCGAACAAAGTGTCAGTGACAAACAAAGGAACCAATGCT
GCAATAGAGCATCAGGTGGCAGAACCCAAGTTCGATGCGCCCGATACCGTCCACATCAAGCGCACTTTCAACTTT
GCAGGACGTATTCACACTGAAGAAAAGGTCGTTGCTCGAGATTCGGCCGAAGCAAAGCTCTTCCTCGCCTCACAG
GCCACAGACACCTCGGCGCAAACATCACCTGCAAAGAGGGCTACTAAGAAGGCATTTCGCTCACGATTTGAACCC
GTCATTGATGATGGCTCAGGCCGCACAGATCTCGATCTCAGCCTGGCGGCGCGGACAAATGCGGCCAAGGAGGCA
CAAGCCCAGAAGCTCAACACGGTAGAGAAGAGTCGCATGGACTGGGCGGGCTATGTTGACAAAGAAGGAATCAAG
GACGAGCTCCAGTTGGCCAGCAAGGCAAAAGATTCATATAATTCCAGAGAGGATTTTCTGGCCCGCAGCGAGGCC
GTGCGCCAAGAGGAGGTAAGAAGAGCCCGAATGGCCGGACGAACGTGA
Gene >OphauG2|3733
ATGCCTTCAGACCTCATCGAAAACGACAATGATCACGACCAGTACATATCCTCTGAGGACTCGGACTTCGCCCCA
GATGACACACACGAGCAGGCTTCCACACAGTCCGACTCTGACAAGGAGGCTCCTGAGCCGTCAAACAAGCAACGG
CTGAAAGGCGACAACCAAGGCTACGACAACTCGGGTGACGAGACGATAATCAAGAAAGGCCATAAACGGCGAAAA
CGCGCACAACAAAAGGGAGAGACGTCGGATGGCCAAGACGGCAGCCCTAGTGGCCTGATCAAAACCAGAAGGCAA
CGCGCCCACGAGTACGGCTTTCCCTCCCCTCAATTCCAAACCCTCTGATGCTGACCTGGCACGTAGAAGAGCTGA
ACGCCATCACTTGGTTCACAATGGACCTGTGGCCGTCGACGTTGATGCGCTATGGCAGCAAATGATATCTGGCCA
GCCAAGAAGCCCAGGTTCGAACAAAGTGTCAGTGACAAACAAAGGAACCAATGCTGCAATAGAGCATCAGGTGGC
AGAACCCAAGTTCGATGCGCCCGATACCGTCCACATCAAGCGCACTTTCAACTTTGCAGGACGTATTCACACTGA
AGAAAAGGTCGTTGCTCGAGATTCGGCCGAAGCAAAGCTCTTCCTCGCCTCACAGGCCACAGACACCTCGGCGCA
AACATCACCTGCAAAGAGGGCTACTAAGAAGGCATTTCGCTCACGATTTGAACCCGTCATTGATGATGGCTCAGG
CCGCACAGATCTCGATCTCAGCCTGGCGGCGCGGACAAATGCGGCCAAGGAGGCACAAGCCCAGAAGCTCAACAC
GGTAGAGAAGAGTCGCATGGACTGGGCGGGCTATGTTGACAAAGAAGGAATCAAGGACGAGCTCCAGTTGGCCAG
CAAGGCAAAAGATTCATATAATTCCAGAGAGGATTTTCTGGCCCGCAGCGAGGCCGTGCGCCAAGAGGAGGTAAG
AAGAGCCCGAATGGCCGGACGAACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail