Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3730
Gene name
LocationContig_290:921..5510
Strand-
Gene length (bp)4589
Transcript length (bp)4425
Coding sequence length (bp)4425
Protein length (aa) 1475

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.1E-78 592 885
PF00271 Helicase_C Helicase conserved C-terminal domain 1.8E-18 909 1022
PF00439 Bromodomain Bromodomain 3.4E-18 1330 1401
PF07529 HSA HSA domain 5.5E-18 422 492
PF14619 SnAC Snf2-ATP coupling, chromatin remodelling complex 7.6E-16 1129 1186
PF08880 QLQ QLQ 2.4E-10 187 220
PF04851 ResIII Type III restriction enzyme, res subunit 2.0E-10 589 748

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 323 1417 0.0E+00
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 149 1427 0.0E+00
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 303 1287 0.0E+00
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 326 1202 0.0E+00
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 543 1417 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 323 1417 0.0E+00
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 149 1427 0.0E+00
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 303 1287 0.0E+00
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 326 1202 0.0E+00
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 543 1417 0.0E+00
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 566 1410 0.0E+00
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 543 1417 0.0E+00
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 543 1417 0.0E+00
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 543 1417 0.0E+00
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 566 1410 0.0E+00
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 566 1189 0.0E+00
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 324 1235 0.0E+00
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 319 1220 0.0E+00
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 404 1148 0.0E+00
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 586 1106 3.0E-152
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 504 1106 5.0E-149
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 510 1104 7.0E-149
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 510 1104 2.0E-148
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 573 1106 4.0E-148
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 348 1118 1.0E-146
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 510 1107 3.0E-146
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 473 1107 9.0E-146
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 503 1061 9.0E-145
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 473 1107 3.0E-144
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 577 1060 6.0E-143
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 510 1062 5.0E-142
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 510 1078 9.0E-135
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 579 1107 2.0E-125
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 575 1111 4.0E-125
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 576 1122 6.0E-125
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 577 1122 8.0E-123
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 579 1071 4.0E-122
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 568 1118 2.0E-120
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 579 1106 4.0E-120
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 568 1058 8.0E-120
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 589 1124 4.0E-118
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 585 1076 8.0E-118
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 585 1095 7.0E-117
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 585 1101 2.0E-116
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 585 1101 7.0E-116
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 584 1129 8.0E-116
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 585 1101 9.0E-116
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 585 1076 1.0E-115
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 586 1058 3.0E-115
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 586 1058 3.0E-115
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 585 1058 5.0E-115
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 584 1057 2.0E-114
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 584 1107 2.0E-113
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 572 1076 3.0E-113
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 568 1076 7.0E-113
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 585 1111 8.0E-113
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 585 1060 1.0E-112
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 575 1064 7.0E-112
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 589 1107 1.0E-110
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 589 1153 8.0E-110
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 589 1153 1.0E-109
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 565 1057 2.0E-109
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 589 1153 3.0E-109
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 586 1111 4.0E-109
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 589 1153 7.0E-109
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 568 1104 7.0E-109
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 585 1060 7.0E-109
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 589 1153 1.0E-108
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 585 1060 1.0E-108
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 589 1153 1.0E-108
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 586 1111 1.0E-108
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 589 1216 3.0E-107
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 589 1216 3.0E-107
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 589 1216 4.0E-107
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 586 1111 1.0E-106
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 577 1105 5.0E-101
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 577 1053 5.0E-98
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 576 1108 3.0E-95
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 585 1079 2.0E-93
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 589 1064 2.0E-91
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 588 1079 3.0E-91
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 573 1077 2.0E-90
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 578 1077 3.0E-90
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 573 1077 5.0E-90
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 573 1077 2.0E-89
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 589 1053 1.0E-88
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 577 1061 5.0E-87
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 586 1096 1.0E-85
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 589 1058 7.0E-84
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 589 1074 2.0E-82
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 589 1099 9.0E-81
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 581 1056 9.0E-81
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 588 1056 1.0E-80
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 583 1057 7.0E-80
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 589 1072 8.0E-79
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 550 1058 6.0E-77
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 589 1058 2.0E-76
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 585 1097 5.0E-75
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 584 940 1.0E-72
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 583 887 1.0E-72
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 561 1078 2.0E-72
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 584 996 4.0E-72
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 584 920 5.0E-72
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 584 887 5.0E-72
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 549 907 8.0E-72
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 584 911 2.0E-71
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 576 898 4.0E-71
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 583 912 4.0E-71
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 583 887 5.0E-71
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 584 900 6.0E-71
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 584 917 7.0E-71
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 584 902 9.0E-71
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 584 900 1.0E-70
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 584 971 2.0E-70
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 583 912 3.0E-70
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 589 1071 6.0E-70
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 580 900 2.0E-69
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 589 900 3.0E-69
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 401 899 3.0E-69
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 584 898 4.0E-69
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 580 899 5.0E-69
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 584 898 5.0E-69
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 585 1108 6.0E-69
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 401 899 6.0E-69
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 584 900 7.0E-69
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 533 899 1.0E-68
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 577 886 2.0E-68
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 583 903 2.0E-68
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 584 886 2.0E-68
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 576 899 2.0E-68
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 584 890 2.0E-68
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 589 899 3.0E-68
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 584 891 4.0E-68
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 585 1057 4.0E-68
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 589 1049 7.0E-68
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 584 898 7.0E-68
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 584 1057 7.0E-68
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 558 887 1.0E-67
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 584 910 5.0E-67
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 584 1068 7.0E-67
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 584 1068 8.0E-67
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 578 890 9.0E-67
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 583 902 1.0E-66
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 583 902 1.0E-66
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 576 900 1.0E-66
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 589 1049 1.0E-66
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 584 1068 2.0E-66
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 580 888 2.0E-66
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 584 1068 3.0E-66
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 584 1068 3.0E-66
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 584 899 3.0E-66
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 584 892 4.0E-66
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 584 1068 4.0E-66
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 589 896 1.0E-65
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 589 896 1.0E-65
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 584 1068 1.0E-65
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 576 899 2.0E-65
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 576 899 2.0E-65
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 584 1068 4.0E-65
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 589 899 6.0E-65
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 605 1112 9.0E-65
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 584 898 1.0E-64
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 589 1057 1.0E-64
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 589 1049 4.0E-64
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 588 1057 5.0E-64
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 584 918 1.0E-63
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 584 1068 3.0E-63
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 585 1049 4.0E-63
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 589 1049 1.0E-62
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 589 1087 1.0E-62
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 589 1065 2.0E-62
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 562 1057 9.0E-62
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 584 898 1.0E-61
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 608 1061 1.0E-61
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 584 849 2.0E-60
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 589 1057 1.0E-59
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 584 1092 1.0E-59
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 589 1057 2.0E-59
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 611 1059 3.0E-59
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 611 1070 4.0E-59
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 584 1057 4.0E-59
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 611 1070 6.0E-59
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 611 1070 6.0E-59
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 611 1070 1.0E-58
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 611 1070 2.0E-58
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 588 1044 1.0E-57
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 587 1059 8.0E-57
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 587 1044 1.0E-56
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 869 1106 2.0E-50
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 609 1094 2.0E-50
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 585 1057 4.0E-46
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 572 887 1.0E-45
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 572 887 2.0E-45
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 907 1087 6.0E-43
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 907 1098 9.0E-43
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 907 1062 3.0E-42
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 907 1062 4.0E-42
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 907 1087 5.0E-42
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 907 1062 8.0E-42
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 907 1087 1.0E-41
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 907 1094 1.0E-41
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 907 1148 1.0E-41
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 907 1153 1.0E-41
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 903 1087 1.0E-41
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 907 1060 2.0E-41
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 907 1094 3.0E-41
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 907 1094 3.0E-41
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 907 1094 3.0E-41
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 882 1062 3.0E-41
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 578 1057 4.0E-41
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 907 1094 6.0E-41
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 907 1064 7.0E-41
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 885 1057 7.0E-41
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 907 1105 9.0E-41
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 907 1094 2.0E-40
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 902 1062 4.0E-40
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 907 1057 4.0E-40
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 907 1057 4.0E-40
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 902 1062 5.0E-40
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 907 1065 8.0E-40
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 789 1108 1.0E-39
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 902 1062 2.0E-39
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 883 1049 2.0E-39
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 907 1097 3.0E-39
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 907 1056 3.0E-39
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 907 1056 3.0E-39
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 866 1064 4.0E-39
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 866 1064 4.0E-39
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 907 1057 8.0E-39
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 902 1107 1.0E-38
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 875 1090 2.0E-38
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 872 1108 3.0E-38
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 902 1108 3.0E-38
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 899 1049 3.0E-38
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 899 1065 4.0E-38
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 713 1057 4.0E-38
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 899 1056 5.0E-38
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 589 1045 6.0E-38
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 902 1101 2.0E-37
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 902 1062 2.0E-37
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 907 1058 2.0E-37
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 902 1062 3.0E-37
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 902 1062 4.0E-37
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 902 1108 1.0E-36
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 886 1066 2.0E-36
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 713 1057 3.0E-35
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 249 529 4.0E-35
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 713 1057 1.0E-34
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 592 1044 1.0E-33
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 307 529 2.0E-33
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 592 1057 1.0E-32
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 307 530 2.0E-32
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 307 530 3.0E-32
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 307 530 3.0E-32
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 307 530 8.0E-32
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 907 1072 2.0E-31
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 592 1057 3.0E-31
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 307 582 2.0E-30
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 611 1073 1.0E-29
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 611 1042 2.0E-29
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 607 1206 8.0E-29
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 588 1094 3.0E-28
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 589 896 3.0E-28
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 589 1094 5.0E-28
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 611 1101 1.0E-27
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 589 886 5.0E-27
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 611 1122 5.0E-27
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 611 1056 8.0E-27
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 907 1044 9.0E-27
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 611 1072 9.0E-27
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 589 886 9.0E-27
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 589 886 9.0E-27
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 589 886 1.0E-26
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 907 1044 3.0E-26
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 589 901 3.0E-26
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 611 1070 3.0E-24
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 589 1046 3.0E-24
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 579 894 4.0E-24
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 589 1046 8.0E-24
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 609 885 1.0E-23
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 589 1046 3.0E-23
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 589 1036 5.0E-23
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 610 885 6.0E-22
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 907 1057 2.0E-21
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 907 1057 2.0E-21
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 907 1057 2.0E-21
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 907 1057 3.0E-21
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 904 1042 9.0E-21
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 610 883 1.0E-20
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 903 1065 1.0E-20
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 610 882 2.0E-20
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 585 1039 2.0E-20
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 610 895 3.0E-20
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 928 1056 1.0E-19
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 589 1041 2.0E-19
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 904 1042 3.0E-19
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 905 1043 3.0E-19
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 905 1044 7.0E-19
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 610 882 7.0E-19
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 926 1079 8.0E-19
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 588 857 8.0E-19
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 609 1034 8.0E-19
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 607 1064 9.0E-19
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 572 885 1.0E-18
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 921 1070 2.0E-18
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 904 1043 2.0E-18
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 928 1048 2.0E-18
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 610 880 3.0E-18
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 586 883 3.0E-18
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 608 885 4.0E-18
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 926 1049 4.0E-18
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 926 1049 4.0E-18
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 886 1043 4.0E-18
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 928 1044 6.0E-18
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 588 818 1.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 900 1080 2.0E-17
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 608 885 3.0E-17
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 871 1048 3.0E-17
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 926 1048 4.0E-17
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 926 1043 4.0E-17
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 610 902 5.0E-17
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 900 1070 5.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 642 882 1.0E-16
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 610 924 1.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 608 890 1.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 589 882 1.0E-16
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 610 883 2.0E-16
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 922 1043 2.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 921 1062 2.0E-16
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 907 1075 3.0E-16
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 905 1044 4.0E-16
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 904 1052 4.0E-16
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 926 1044 4.0E-16
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 611 849 6.0E-16
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 900 1065 7.0E-16
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 922 1043 9.0E-16
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 608 885 1.0E-15
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 642 886 1.0E-15
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 642 883 2.0E-15
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 610 1059 5.0E-15
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 642 882 6.0E-15
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 907 1045 6.0E-15
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 904 1075 7.0E-15
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 912 1069 3.0E-14
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 912 1069 4.0E-14
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 893 1056 9.0E-14
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 906 1056 1.0E-13
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1325 1448 2.0E-13
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 573 833 6.0E-13
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 642 881 3.0E-12
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 1323 1401 7.0E-12
sp|Q9M658|MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana GN=MOM1 PE=1 SV=1 868 1047 8.0E-12
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1330 1419 1.0E-11
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1330 1419 1.0E-11
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 587 833 4.0E-11
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 642 885 5.0E-11
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 642 885 5.0E-11
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 701 883 4.0E-10
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1330 1451 8.0E-10
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1330 1451 8.0E-10
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1330 1451 1.0E-09
sp|P53236|RSC1_YEAST Chromatin structure-remodeling complex subunit RSC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC1 PE=1 SV=1 1289 1419 1.0E-09
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 1330 1408 2.0E-09
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1284 1414 2.0E-09
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 926 1080 2.0E-09
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 1336 1399 3.0E-09
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1324 1414 4.0E-09
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 713 884 5.0E-09
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1321 1414 5.0E-09
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 1335 1420 1.0E-08
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 705 848 2.0E-08
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 926 1049 2.0E-08
sp|Q06488|RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC2 PE=1 SV=1 1296 1422 4.0E-08
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1297 1414 5.0E-08
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 1342 1422 5.0E-08
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 1217 1445 6.0E-08
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1297 1404 2.0E-07
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1297 1404 2.0E-07
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 952 1039 2.0E-07
sp|Q8UVR5|BAZ1A_XENLA Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis GN=baz1a PE=2 SV=1 1258 1437 3.0E-07
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 1214 1409 3.0E-07
sp|O74964|RSC1_SCHPO Chromatin structure-remodeling complex subunit rsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc1 PE=1 SV=1 1326 1415 5.0E-07
sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 1335 1423 5.0E-07
sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 1335 1417 5.0E-07
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1335 1434 9.0E-07
sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 1335 1416 1.0E-06
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 1335 1414 2.0E-06
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1323 1408 3.0E-06
sp|Q02206|RSC4_YEAST Chromatin structure-remodeling complex subunit RSC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC4 PE=1 SV=2 1335 1427 3.0E-06
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 1335 1414 3.0E-06
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 1344 1412 4.0E-06
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 1347 1450 5.0E-06
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1323 1408 6.0E-06
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 1335 1414 7.0E-06
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1323 1408 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0042393 histone binding Yes
GO:0005634 nucleus Yes
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0016787 hydrolase activity Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No
GO:0043168 anion binding No
GO:0003676 nucleic acid binding No
GO:0043167 ion binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0000166 nucleotide binding No
GO:0050794 regulation of cellular process No
GO:0036094 small molecule binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0051252 regulation of RNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0009889 regulation of biosynthetic process No
GO:0043229 intracellular organelle No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043227 membrane-bounded organelle No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1365
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3730 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6379
Ophiocordyceps camponoti-floridani Ophcf2|04921
Ophiocordyceps camponoti-rufipedis Ophun1|5626
Ophiocordyceps kimflemingae Ophio5|585
Ophiocordyceps subramaniannii Hirsu2|10789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3730
MASVQAPPPAVQHPGAPMLANVTKQQAEEIFKKLMQMKEHGVPPSDPEYIKASQLLFNFQQQHALRKNQLNFQQQ
QQQQHQHHHHHQQQQPQPQPQQHTQPPQPSQQPQPQSEAHQAQQQQQQHMQMPNISNGTLNGGGQSARPQQGSTP
QPSQPALNSQASFSSLNQSPGTGPGMAPAARSSSSQFSQQQLSLLRQQIQAFKLLSKNAGVSVQLQQAIFNQRQR
RQAPFVEPSQGAQAKQTPTLSDGTKPVPSGSATTPQDAQSSLLQGQTFKSVKSPYGNIIRPTIKYLDHAQRKNRW
FIPGLFPTGIDFDHIRYERETILKNRMAQRCAELASLPANIAHVDATRGTLEPDDSLKLKAIIEMKSLHLYVRQQ
KLRDKIGRQMIYYDNLAMTTNRSLYRRMKKQNVREARITEKLEKQQRDARENREKKKHVDFLRAICHHRSEIHEA
ANTQRTKSHKLSRLMYAQHFNIEKEEQKRIERTAKQRLQALKANDEEAYLKLLDQAKDTRITHLLKQTDGFLHQL
ASSVKAQQRQAAETYGEDLEHLVEEEEEDGGEGEGGKKIDYYAVAHRIREEVTEQANILVGGTLKEYQLKGLQWM
LSLYNNNLNGILADEMGLGKTIQTISLITYLIERKHQSGPYLVIVPLSTLTNWNLEFEKWAPSVSRIVYKGPPNT
RKQQQEKIRQGRFQVLLTTYEYIIKDRPILSKIKWFHMIIDEGHRMKNSNSKLSATISQYYNTRFRLILTGTPLQ
NNLSELWAMLNFVLPNIFKSVKTFDEWFNTPFANTGGQDKMELTEEEQILVIRRLHKVLRPFLLRRLKKDVEKDL
PDKTEKVVKCKFSALQSRLYKQMVTHNKLVVSDGKGGRTSARGLSNMIMQLRKLCNHPFVFDEVENVMNPMSISN
DMLWRTAGKFELLDRILPKYQATGHRVLMFFQMTAIMDIMEDYLRYRKLEYLRLDGTTKSDERSDLLREFNAPNS
KYFMFLLSTRAGGLGLNLQTADTVIIYDSDWNPHQDLQAQDRAHRIGQKNEVRILRLISSNSVEEKILERARFKL
DMDGKVIQAGRFDNKSSETDRDAMLRTLLETADMAELGDQDDMEDEELNMMLARSDDELVVFQKLDEERQHDPIY
GSLGAGTKAKPRLMGEEELPDIYLNEGNPVEDDNEEVVLGRGARERTKVRYDDGLTEEQWLMAVDDDEDSPEAAA
QRKQARKDKREFNRVKKMAAGNSIENSPTGSRGSTEEIETPRKRGRKPGGKNEKRKAEDGEDEPPAKKRRGPQGR
PSKIGLVGGSESRLTGQQREVLQKSLRYLYEALMTFEVDDIEPPAEDDESDAGKRLIIGPFVKLPPKRDYADYYV
IIKNPICMNQIQTRIKKEEYTCLGDMRRDFELMIRNCQTYNEDGSVLYQDASTMEEFFNTKYREEMEAHVELQEL
EEGVKSNSVAPSGNGETSQSGGTRIRIVSSSGRDVPNGMRPKGEQSDDE*
Coding >OphauG2|3730
ATGGCCTCGGTCCAAGCTCCTCCGCCTGCTGTTCAGCATCCTGGCGCCCCCATGCTTGCCAACGTCACCAAGCAG
CAGGCAGAGGAGATCTTCAAGAAATTGATGCAGATGAAGGAGCATGGTGTTCCCCCTTCGGATCCGGAGTACATC
AAGGCCTCTCAACTGCTCTTCAACTTCCAGCAGCAGCATGCATTGCGCAAGAACCAGCTTAATTTTCAGCAGCAG
CAGCAACAGCAGCACCAACATCATCATCATCATCAACAACAACAACCACAGCCGCAACCTCAGCAACACACACAG
CCTCCCCAACCTTCGCAACAACCGCAACCCCAATCAGAAGCCCATCAAGCCCAACAGCAACAGCAACAGCATATG
CAGATGCCAAATATTTCCAATGGGACCCTGAATGGCGGCGGCCAGAGCGCGCGCCCGCAACAGGGATCTACCCCA
CAGCCATCCCAGCCGGCTCTCAATTCACAAGCATCCTTCTCGTCTCTGAACCAAAGTCCAGGAACTGGTCCTGGC
ATGGCACCTGCCGCCCGGTCCTCATCCAGTCAATTCAGCCAGCAGCAGCTTTCCCTCCTCAGACAACAGATTCAA
GCATTCAAGCTTCTCAGCAAGAATGCAGGCGTCTCAGTTCAGCTGCAACAAGCCATCTTTAACCAACGTCAACGT
CGGCAAGCACCTTTCGTCGAACCATCCCAGGGTGCACAGGCAAAGCAAACTCCGACTCTATCGGATGGCACAAAA
CCGGTACCTTCAGGCTCTGCTACAACGCCTCAGGATGCACAATCCAGTCTGCTACAAGGCCAGACTTTCAAATCT
GTAAAGTCGCCGTACGGAAACATTATTCGCCCTACAATCAAGTACTTGGATCATGCTCAGCGCAAGAATCGGTGG
TTCATTCCCGGTCTCTTCCCCACCGGTATTGATTTCGATCACATTCGATATGAAAGAGAGACAATTCTCAAGAAC
CGCATGGCTCAAAGATGTGCTGAACTCGCCAGCCTCCCTGCCAATATTGCTCACGTAGATGCTACCAGGGGGACA
CTTGAGCCTGATGATTCGCTCAAGTTGAAAGCCATTATTGAGATGAAGAGTCTGCATCTCTACGTCAGGCAACAA
AAGCTCCGCGATAAGATTGGACGACAAATGATCTACTATGACAATCTAGCCATGACTACTAACCGATCTCTTTAT
CGTCGCATGAAGAAGCAAAACGTTCGTGAAGCTCGCATTACTGAGAAGCTTGAGAAGCAGCAGCGTGACGCTCGA
GAGAACCGCGAAAAGAAGAAGCATGTGGACTTCCTCCGTGCCATTTGCCATCATCGCTCGGAAATCCACGAAGCT
GCCAATACTCAGCGTACAAAGTCTCACAAGCTTAGCCGTCTTATGTATGCGCAGCATTTCAACATTGAAAAGGAA
GAGCAGAAGCGCATCGAGCGGACTGCCAAGCAGCGTCTGCAGGCGCTCAAGGCCAATGACGAAGAGGCCTACCTC
AAGCTTCTCGACCAGGCCAAGGATACGCGCATCACCCACCTCCTCAAACAGACGGATGGCTTCTTGCATCAGCTT
GCATCCTCGGTCAAGGCGCAACAGCGGCAGGCTGCCGAGACATATGGCGAAGACCTGGAGCATTTGGTGGAAGAA
GAAGAAGAAGACGGCGGCGAAGGCGAAGGCGGCAAGAAGATTGACTACTACGCAGTCGCACATCGCATTCGAGAA
GAGGTTACTGAACAGGCCAATATCCTTGTTGGTGGAACGCTCAAAGAGTACCAACTCAAGGGTCTCCAGTGGATG
CTGTCACTCTACAACAACAATCTCAATGGTATTCTTGCTGACGAAATGGGTCTTGGCAAGACAATTCAGACCATT
TCGCTCATCACCTATCTGATTGAACGCAAGCATCAGAGCGGGCCCTATCTCGTCATTGTACCCCTGAGCACTTTG
ACCAACTGGAATCTGGAGTTTGAGAAGTGGGCACCCTCTGTTTCTCGCATCGTTTACAAGGGGCCACCAAACACG
CGCAAACAGCAGCAGGAAAAAATACGCCAGGGACGATTTCAGGTGCTTCTTACCACGTACGAGTACATCATCAAG
GACCGGCCAATTCTCAGCAAAATAAAGTGGTTCCACATGATTATTGATGAAGGCCACCGCATGAAGAATTCAAAC
TCGAAGCTCAGCGCAACAATTTCTCAATACTACAATACCCGTTTTCGACTTATCCTCACTGGTACTCCACTACAA
AATAATCTGTCGGAACTATGGGCCATGCTTAATTTTGTCTTGCCCAACATCTTCAAGTCTGTCAAGACATTTGAC
GAGTGGTTCAACACTCCTTTTGCAAACACGGGCGGCCAAGACAAAATGGAGCTTACTGAAGAAGAACAAATTCTT
GTTATTCGCCGACTGCACAAGGTTCTGCGCCCCTTCCTGCTGCGTCGCTTGAAGAAGGACGTTGAAAAGGACTTG
CCAGACAAGACGGAAAAGGTTGTCAAGTGCAAGTTCTCTGCCCTCCAATCAAGGCTGTACAAGCAAATGGTGACG
CACAACAAGCTTGTTGTCAGCGACGGCAAGGGTGGAAGGACAAGTGCACGGGGCCTGAGCAACATGATTATGCAG
TTGCGAAAGCTTTGCAATCACCCCTTTGTTTTTGACGAGGTTGAAAATGTCATGAATCCCATGAGCATCAGCAAC
GACATGTTGTGGAGGACGGCGGGAAAGTTTGAGTTGCTTGATCGAATTCTGCCCAAGTATCAGGCCACTGGCCAT
CGTGTCTTGATGTTCTTCCAAATGACTGCCATCATGGACATCATGGAAGATTACTTGCGCTACAGAAAACTAGAG
TACTTACGATTGGACGGCACAACCAAGTCGGACGAGAGATCAGATCTTCTGCGCGAGTTCAATGCCCCCAACTCC
AAGTACTTTATGTTTTTGCTGTCGACGCGTGCTGGTGGATTGGGTCTCAACCTGCAAACAGCAGATACAGTCATT
ATCTATGATTCTGATTGGAATCCGCACCAAGATCTGCAAGCTCAAGATCGCGCGCATCGCATCGGTCAGAAGAAT
GAAGTGCGAATTCTGCGACTGATTAGCTCCAATTCTGTTGAAGAAAAGATTTTGGAACGCGCAAGGTTCAAGCTG
GATATGGACGGCAAAGTTATCCAGGCAGGTAGATTTGACAACAAGTCTTCAGAGACTGATCGTGATGCCATGCTA
CGCACGCTTTTAGAGACGGCAGACATGGCAGAGCTGGGAGATCAAGACGACATGGAGGACGAAGAGCTGAACATG
ATGCTTGCCCGGAGCGACGATGAACTAGTCGTGTTCCAAAAACTGGATGAGGAACGGCAGCATGATCCCATCTAT
GGGTCCTTGGGCGCCGGGACCAAAGCCAAGCCGCGCCTCATGGGCGAAGAAGAGCTGCCAGATATATATCTCAAC
GAGGGAAATCCCGTAGAGGACGACAACGAAGAGGTGGTGCTGGGGCGAGGGGCTCGCGAGCGCACCAAGGTGCGA
TACGACGACGGCCTGACGGAAGAACAGTGGCTCATGGCTGTTGATGACGACGAGGACTCGCCCGAGGCTGCGGCA
CAGCGCAAGCAAGCGCGCAAGGACAAGCGCGAGTTCAATAGAGTCAAAAAGATGGCAGCTGGCAATTCAATTGAG
AACTCACCAACGGGAAGCCGGGGAAGCACTGAAGAGATTGAGACGCCCAGAAAAAGAGGCCGCAAGCCCGGCGGC
AAGAACGAGAAGCGCAAGGCAGAGGACGGCGAAGACGAGCCCCCAGCCAAGAAGCGGCGAGGACCACAGGGAAGA
CCTAGCAAGATTGGACTAGTAGGTGGCTCAGAGTCACGACTGACTGGACAGCAGCGCGAGGTGCTGCAGAAGAGC
TTGCGATATTTATATGAGGCGCTGATGACGTTTGAGGTGGACGATATTGAGCCACCGGCCGAGGATGACGAATCT
GACGCGGGCAAGCGACTCATTATTGGCCCCTTTGTCAAACTACCTCCCAAGCGTGATTACGCCGACTACTATGTC
ATCATCAAGAACCCCATTTGCATGAATCAAATCCAGACTCGCATCAAGAAGGAGGAATACACTTGCCTTGGCGAC
ATGCGCAGGGACTTTGAGCTCATGATACGCAACTGCCAGACGTACAATGAGGATGGCAGCGTGTTGTATCAGGAT
GCCTCGACAATGGAGGAGTTTTTCAACACCAAGTATCGCGAAGAAATGGAGGCGCATGTAGAGCTGCAAGAGTTG
GAGGAAGGGGTCAAATCAAATTCTGTGGCGCCTTCAGGCAACGGCGAAACATCACAGTCTGGGGGAACGCGCATT
CGGATCGTTTCGAGCAGCGGACGTGACGTGCCCAACGGGATGCGGCCCAAGGGGGAGCAAAGCGACGATGAGTAA
Transcript >OphauG2|3730
ATGGCCTCGGTCCAAGCTCCTCCGCCTGCTGTTCAGCATCCTGGCGCCCCCATGCTTGCCAACGTCACCAAGCAG
CAGGCAGAGGAGATCTTCAAGAAATTGATGCAGATGAAGGAGCATGGTGTTCCCCCTTCGGATCCGGAGTACATC
AAGGCCTCTCAACTGCTCTTCAACTTCCAGCAGCAGCATGCATTGCGCAAGAACCAGCTTAATTTTCAGCAGCAG
CAGCAACAGCAGCACCAACATCATCATCATCATCAACAACAACAACCACAGCCGCAACCTCAGCAACACACACAG
CCTCCCCAACCTTCGCAACAACCGCAACCCCAATCAGAAGCCCATCAAGCCCAACAGCAACAGCAACAGCATATG
CAGATGCCAAATATTTCCAATGGGACCCTGAATGGCGGCGGCCAGAGCGCGCGCCCGCAACAGGGATCTACCCCA
CAGCCATCCCAGCCGGCTCTCAATTCACAAGCATCCTTCTCGTCTCTGAACCAAAGTCCAGGAACTGGTCCTGGC
ATGGCACCTGCCGCCCGGTCCTCATCCAGTCAATTCAGCCAGCAGCAGCTTTCCCTCCTCAGACAACAGATTCAA
GCATTCAAGCTTCTCAGCAAGAATGCAGGCGTCTCAGTTCAGCTGCAACAAGCCATCTTTAACCAACGTCAACGT
CGGCAAGCACCTTTCGTCGAACCATCCCAGGGTGCACAGGCAAAGCAAACTCCGACTCTATCGGATGGCACAAAA
CCGGTACCTTCAGGCTCTGCTACAACGCCTCAGGATGCACAATCCAGTCTGCTACAAGGCCAGACTTTCAAATCT
GTAAAGTCGCCGTACGGAAACATTATTCGCCCTACAATCAAGTACTTGGATCATGCTCAGCGCAAGAATCGGTGG
TTCATTCCCGGTCTCTTCCCCACCGGTATTGATTTCGATCACATTCGATATGAAAGAGAGACAATTCTCAAGAAC
CGCATGGCTCAAAGATGTGCTGAACTCGCCAGCCTCCCTGCCAATATTGCTCACGTAGATGCTACCAGGGGGACA
CTTGAGCCTGATGATTCGCTCAAGTTGAAAGCCATTATTGAGATGAAGAGTCTGCATCTCTACGTCAGGCAACAA
AAGCTCCGCGATAAGATTGGACGACAAATGATCTACTATGACAATCTAGCCATGACTACTAACCGATCTCTTTAT
CGTCGCATGAAGAAGCAAAACGTTCGTGAAGCTCGCATTACTGAGAAGCTTGAGAAGCAGCAGCGTGACGCTCGA
GAGAACCGCGAAAAGAAGAAGCATGTGGACTTCCTCCGTGCCATTTGCCATCATCGCTCGGAAATCCACGAAGCT
GCCAATACTCAGCGTACAAAGTCTCACAAGCTTAGCCGTCTTATGTATGCGCAGCATTTCAACATTGAAAAGGAA
GAGCAGAAGCGCATCGAGCGGACTGCCAAGCAGCGTCTGCAGGCGCTCAAGGCCAATGACGAAGAGGCCTACCTC
AAGCTTCTCGACCAGGCCAAGGATACGCGCATCACCCACCTCCTCAAACAGACGGATGGCTTCTTGCATCAGCTT
GCATCCTCGGTCAAGGCGCAACAGCGGCAGGCTGCCGAGACATATGGCGAAGACCTGGAGCATTTGGTGGAAGAA
GAAGAAGAAGACGGCGGCGAAGGCGAAGGCGGCAAGAAGATTGACTACTACGCAGTCGCACATCGCATTCGAGAA
GAGGTTACTGAACAGGCCAATATCCTTGTTGGTGGAACGCTCAAAGAGTACCAACTCAAGGGTCTCCAGTGGATG
CTGTCACTCTACAACAACAATCTCAATGGTATTCTTGCTGACGAAATGGGTCTTGGCAAGACAATTCAGACCATT
TCGCTCATCACCTATCTGATTGAACGCAAGCATCAGAGCGGGCCCTATCTCGTCATTGTACCCCTGAGCACTTTG
ACCAACTGGAATCTGGAGTTTGAGAAGTGGGCACCCTCTGTTTCTCGCATCGTTTACAAGGGGCCACCAAACACG
CGCAAACAGCAGCAGGAAAAAATACGCCAGGGACGATTTCAGGTGCTTCTTACCACGTACGAGTACATCATCAAG
GACCGGCCAATTCTCAGCAAAATAAAGTGGTTCCACATGATTATTGATGAAGGCCACCGCATGAAGAATTCAAAC
TCGAAGCTCAGCGCAACAATTTCTCAATACTACAATACCCGTTTTCGACTTATCCTCACTGGTACTCCACTACAA
AATAATCTGTCGGAACTATGGGCCATGCTTAATTTTGTCTTGCCCAACATCTTCAAGTCTGTCAAGACATTTGAC
GAGTGGTTCAACACTCCTTTTGCAAACACGGGCGGCCAAGACAAAATGGAGCTTACTGAAGAAGAACAAATTCTT
GTTATTCGCCGACTGCACAAGGTTCTGCGCCCCTTCCTGCTGCGTCGCTTGAAGAAGGACGTTGAAAAGGACTTG
CCAGACAAGACGGAAAAGGTTGTCAAGTGCAAGTTCTCTGCCCTCCAATCAAGGCTGTACAAGCAAATGGTGACG
CACAACAAGCTTGTTGTCAGCGACGGCAAGGGTGGAAGGACAAGTGCACGGGGCCTGAGCAACATGATTATGCAG
TTGCGAAAGCTTTGCAATCACCCCTTTGTTTTTGACGAGGTTGAAAATGTCATGAATCCCATGAGCATCAGCAAC
GACATGTTGTGGAGGACGGCGGGAAAGTTTGAGTTGCTTGATCGAATTCTGCCCAAGTATCAGGCCACTGGCCAT
CGTGTCTTGATGTTCTTCCAAATGACTGCCATCATGGACATCATGGAAGATTACTTGCGCTACAGAAAACTAGAG
TACTTACGATTGGACGGCACAACCAAGTCGGACGAGAGATCAGATCTTCTGCGCGAGTTCAATGCCCCCAACTCC
AAGTACTTTATGTTTTTGCTGTCGACGCGTGCTGGTGGATTGGGTCTCAACCTGCAAACAGCAGATACAGTCATT
ATCTATGATTCTGATTGGAATCCGCACCAAGATCTGCAAGCTCAAGATCGCGCGCATCGCATCGGTCAGAAGAAT
GAAGTGCGAATTCTGCGACTGATTAGCTCCAATTCTGTTGAAGAAAAGATTTTGGAACGCGCAAGGTTCAAGCTG
GATATGGACGGCAAAGTTATCCAGGCAGGTAGATTTGACAACAAGTCTTCAGAGACTGATCGTGATGCCATGCTA
CGCACGCTTTTAGAGACGGCAGACATGGCAGAGCTGGGAGATCAAGACGACATGGAGGACGAAGAGCTGAACATG
ATGCTTGCCCGGAGCGACGATGAACTAGTCGTGTTCCAAAAACTGGATGAGGAACGGCAGCATGATCCCATCTAT
GGGTCCTTGGGCGCCGGGACCAAAGCCAAGCCGCGCCTCATGGGCGAAGAAGAGCTGCCAGATATATATCTCAAC
GAGGGAAATCCCGTAGAGGACGACAACGAAGAGGTGGTGCTGGGGCGAGGGGCTCGCGAGCGCACCAAGGTGCGA
TACGACGACGGCCTGACGGAAGAACAGTGGCTCATGGCTGTTGATGACGACGAGGACTCGCCCGAGGCTGCGGCA
CAGCGCAAGCAAGCGCGCAAGGACAAGCGCGAGTTCAATAGAGTCAAAAAGATGGCAGCTGGCAATTCAATTGAG
AACTCACCAACGGGAAGCCGGGGAAGCACTGAAGAGATTGAGACGCCCAGAAAAAGAGGCCGCAAGCCCGGCGGC
AAGAACGAGAAGCGCAAGGCAGAGGACGGCGAAGACGAGCCCCCAGCCAAGAAGCGGCGAGGACCACAGGGAAGA
CCTAGCAAGATTGGACTAGTAGGTGGCTCAGAGTCACGACTGACTGGACAGCAGCGCGAGGTGCTGCAGAAGAGC
TTGCGATATTTATATGAGGCGCTGATGACGTTTGAGGTGGACGATATTGAGCCACCGGCCGAGGATGACGAATCT
GACGCGGGCAAGCGACTCATTATTGGCCCCTTTGTCAAACTACCTCCCAAGCGTGATTACGCCGACTACTATGTC
ATCATCAAGAACCCCATTTGCATGAATCAAATCCAGACTCGCATCAAGAAGGAGGAATACACTTGCCTTGGCGAC
ATGCGCAGGGACTTTGAGCTCATGATACGCAACTGCCAGACGTACAATGAGGATGGCAGCGTGTTGTATCAGGAT
GCCTCGACAATGGAGGAGTTTTTCAACACCAAGTATCGCGAAGAAATGGAGGCGCATGTAGAGCTGCAAGAGTTG
GAGGAAGGGGTCAAATCAAATTCTGTGGCGCCTTCAGGCAACGGCGAAACATCACAGTCTGGGGGAACGCGCATT
CGGATCGTTTCGAGCAGCGGACGTGACGTGCCCAACGGGATGCGGCCCAAGGGGGAGCAAAGCGACGATGAGTAA
Gene >OphauG2|3730
ATGGCCTCGGTCCAAGCTCCTCCGCCTGCTGTTCAGCATCCTGGCGCCCCCATGCTTGCCAACGTCACCAAGCAG
CAGGCAGAGGAGATCTTCAAGGTATGCTCTCTCATTCCGCTTCCCACGCGCCAATTCATTCTTGCGCCCAAGCTG
CATCCCTCGCCACAATAGTCGTTTTGCTGCTGACGCGTCGTGATAGAAATTGATGCAGATGAAGGAGCATGGTGT
TCCCCCTTCGGATCCGGAGTACATCAAGGCCTCTCAACTGCTCTTCAACTTCCAGCAGCAGCATGCATTGCGCAA
GAACCAGCTTAATTTTCAGCAGCAGCAGCAACAGCAGCACCAACATCATCATCATCATCAACAACAACAACCACA
GCCGCAACCTCAGCAACACACACAGCCTCCCCAACCTTCGCAACAACCGCAACCCCAATCAGAAGCCCATCAAGC
CCAACAGCAACAGCAACAGCATATGCAGATGCCAAATATTTCCAATGGGACCCTGAATGGCGGCGGCCAGAGCGC
GCGCCCGCAACAGGGATCTACCCCACAGCCATCCCAGCCGGCTCTCAATTCACAAGCATCCTTCTCGTCTCTGAA
CCAAAGTCCAGGAACTGGTCCTGGCATGGCACCTGCCGCCCGGTCCTCATCCAGTCAATTCAGCCAGCAGCAGCT
TTCCCTCCTCAGACAACAGATTCAAGCATTCAAGCTTCTCAGCAAGAATGCAGGCGTCTCAGTTCAGCTGCAACA
AGCCATCTTTAACCAACGTCAACGTCGGCAAGCACCTTTCGTCGAACCATCCCAGGGTGCACAGGCAAAGCAAAC
TCCGACTCTATCGGATGGCACAAAACCGGTACCTTCAGGCTCTGCTACAACGCCTCAGGATGCACAATCCAGTCT
GCTACAAGGCCAGACTTTCAAATCTGTAAAGTCGCCGTACGGAAACATTATTCGCCCTACAATCAAGTACTTGGA
TCATGCTCAGCGCAAGAATCGGTGGTTCATTCCCGGTCTCTTCCCCACCGGTATTGATTTCGATCACATTCGATA
TGAAAGAGAGACAATTCTCAAGAACCGCATGGCTCAAAGATGTGCTGAACTCGCCAGCCTCCCTGCCAATATTGC
TCACGTAGATGCTACCAGGGGGACACTTGAGCCTGATGATTCGCTCAAGTTGAAAGCCATTATTGAGATGAAGAG
TCTGCATCTCTACGTCAGGCAACAAAAGCTCCGCGATAAGATTGGACGACAAATGATCTACTATGACAATCTAGC
CATGACTACTAACCGATCTCTTTATCGTCGCATGAAGAAGCAAAACGTTCGTGAAGCTCGCATTACTGAGAAGCT
TGAGAAGCAGCAGCGTGACGCTCGAGAGAACCGCGAAAAGAAGAAGCATGTGGACTTCCTCCGTGCCATTTGCCA
TCATCGCTCGGAAATCCACGAAGCTGCCAATACTCAGCGTACAAAGTCTCACAAGCTTAGCCGTCTTATGTATGC
GCAGCATTTCAACATTGAAAAGGAAGAGCAGAAGCGCATCGAGCGGACTGCCAAGCAGCGTCTGCAGGCGCTCAA
GGCCAATGACGAAGAGGCCTACCTCAAGCTTCTCGACCAGGCCAAGGATACGCGCATCACCCACCTCCTCAAACA
GACGGATGGCTTCTTGCATCAGCTTGCATCCTCGGTCAAGGCGCAACAGCGGCAGGCTGCCGAGACATATGGCGA
AGACCTGGAGCATTTGGTGGAAGAAGAAGAAGAAGACGGCGGCGAAGGCGAAGGCGGCAAGAAGATTGACTACTA
CGCAGTCGCACATCGCATTCGAGAAGAGGTTACTGAACAGGCCAATATCCTTGTTGGTGGAACGCTCAAAGAGTA
CCAACTCAAGGGTCTCCAGTGGATGCTGTCACTCTACAACAACAATCTCAATGGTATTCTTGCTGACGAAATGGG
TCTTGGCAAGACAATTCAGACCATTTCGCTCATCACCTATCTGATTGAACGCAAGCATCAGAGCGGGCCCTATCT
CGTCATTGTACCCCTGAGCACTTTGACCAACTGGAATCTGGAGTTTGAGAAGTGGGCACCCTCTGTTTCTCGCAT
CGTTTACAAGGGGCCACCAAACACGCGCAAACAGCAGCAGGAAAAAATACGCCAGGGACGATTTCAGGTGCTTCT
TACCACGTACGAGTACATCATCAAGGACCGGCCAATTCTCAGCAAAATAAAGTGGTTCCACATGATTATTGATGA
AGGCCACCGCATGAAGAATTCAAACTCGAAGCTCAGCGCAACAATTTCTCAATACTACAATACCCGTTTTCGACT
TATCCTCACTGGTACTCCACTACAAAATAATCTGTCGGAACTATGGGCCATGCTTAATTTTGTCTTGCCCAACAT
CTTCAAGTCTGTCAAGACATTTGACGAGTGGTTCAACACTCCTTTTGCAAACACGGGCGGCCAAGACAAAATGGA
GCTTACTGAAGAAGAACAAATTCTTGTTATTCGCCGACTGCACAAGGTTCTGCGCCCCTTCCTGCTGCGTCGCTT
GAAGAAGGACGTTGAAAAGGACTTGCCAGACAAGACGGAAAAGGTTGTCAAGTGCAAGTTCTCTGCCCTCCAATC
AAGGCTGTACAAGCAAATGGTGACGCACAACAAGCTTGTTGTCAGCGACGGCAAGGGTGGAAGGACAAGTGCACG
GGGCCTGAGCAACATGATTATGCAGTTGCGAAAGCTTTGCAATCACCCCTTTGTTTTTGACGAGGTTGAAAATGT
CATGAATCCCATGAGCATCAGCAACGACATGTTGTGGAGGACGGCGGGAAAGTTTGAGTTGCTTGATCGAATTCT
GCCCAAGTATCAGGCCACTGGCCATCGTGTCTTGATGTTCTTCCAAATGACTGCCATCATGGACATCATGGAAGA
TTACTTGCGCTACAGAAAACTAGAGTACTTACGATTGGACGGCACAACCAAGTCGGACGAGAGATCAGATCTTCT
GCGCGAGTTCAATGCCCCCAACTCCAAGTACTTTATGTTTTTGCTGTCGACGCGTGCTGGTGGATTGGGTCTCAA
CCTGCAAACAGCAGATACAGTCATTATCTATGATTCTGATTGGAATCCGCACCAAGATCTGCAAGCTCAAGATCG
CGCGCATCGCATCGGTCAGAAGAATGAAGTGCGAATTCTGCGACTGATTAGCTCCAATTCTGTTGAAGAAAAGAT
TTTGGAACGCGCAAGGTTCAAGCTGGATATGGACGGCAAAGTTATCCAGGCAGGTAGATTTGACAACAAGTCTTC
AGAGACTGATCGTGATGCCATGCTACGCACGCTTTTAGAGACGGCAGACATGGCAGAGCTGGGAGATCAAGACGA
CATGGAGGACGAAGAGCTGAACATGATGCTTGCCCGGAGCGACGATGAACTAGTCGTGTTCCAAAAACTGGATGA
GGAACGGCAGCATGATCCCATCTATGGGTCCTTGGGCGCCGGGACCAAAGCCAAGCCGCGCCTCATGGGCGAAGA
AGAGCTGCCAGATATATATCTCAACGAGGGAAATCCCGTAGAGGACGACAACGAAGAGGTGGTGCTGGGGCGAGG
GGCTCGCGAGCGCACCAAGGTGCGATACGACGACGGCCTGACGGAAGAACAGTGGCTCATGGCTGTTGATGACGA
CGAGGACTCGCCCGAGGCTGCGGCACAGCGCAAGCAAGCGCGCAAGGACAAGCGCGAGTTCAATAGAGTCAAAAA
GATGGCAGCTGGCAATTCAATTGAGAACTCACCAACGGGAAGCCGGGGAAGCACTGAAGAGATTGAGACGCCCAG
AAAAAGAGGCCGCAAGCCCGGCGGCAAGAACGAGAAGCGCAAGGCAGAGGACGGCGAAGACGAGCCCCCAGCCAA
GAAGCGGCGAGGACCACAGGGAAGACCTAGCAAGATTGGACTAGTAGGTGGCTCAGAGTCACGACTGACTGGACA
GCAGCGCGAGGTGCTGCAGAAGAGCTTGCGATATTTATATGAGGCGCTGATGACGTTTGAGGTGGACGATATTGA
GCCACCGGCCGAGGATGACGAATCTGACGCGGGCAAGCGACTCATTATTGGCCCCTTTGTCAAACTACCTCCCAA
GCGTGATTACGCCGACTACTATGTCATCATCAAGAACCCCATTTGCATGAATCAAATCCAGACTCGCATCAAGAA
GGAGGAATACACTTGCCTTGGCGACATGCGCAGGGACTTTGAGCTCATGATACGCAACTGCCAGACGTACAATGA
GGATGGCAGCGTGTTGTATCAGGATGCCTCGACAATGGAGGTGAGGACATGAGGTGAAGAAAGTAGGGATTTTGT
GGGCAGGGTTGCTGACATGGTGTGACCAGGAGTTTTTCAACACCAAGTATCGCGAAGAAATGGAGGCGCATGTAG
AGCTGCAAGAGTTGGAGGAAGGGGTCAAATCAAATTCTGTGGCGCCTTCAGGCAACGGCGAAACATCACAGTCTG
GGGGAACGCGCATTCGGATCGTTTCGAGCAGCGGACGTGACGTGCCCAACGGGATGCGGCCCAAGGGGGAGCAAA
GCGACGATGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail