Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3721
Gene name
LocationContig_29:27892..29315
Strand-
Gene length (bp)1423
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00348 polyprenyl_synt Polyprenyl synthetase 5.1E-70 101 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S565|COQ1_NEUCR Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02305 PE=3 SV=1 1 445 0.0E+00
sp|Q6CBH3|COQ1_YARLI Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ1 PE=3 SV=1 40 445 2.0E-142
sp|P18900|COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ1 PE=1 SV=1 37 445 9.0E-111
sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 80 445 1.0E-104
sp|Q5T2R2|DPS1_HUMAN Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1 67 445 6.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S565|COQ1_NEUCR Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02305 PE=3 SV=1 1 445 0.0E+00
sp|Q6CBH3|COQ1_YARLI Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ1 PE=3 SV=1 40 445 2.0E-142
sp|P18900|COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ1 PE=1 SV=1 37 445 9.0E-111
sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 80 445 1.0E-104
sp|Q5T2R2|DPS1_HUMAN Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1 67 445 6.0E-86
sp|Q33DR2|DPS1_MOUSE Decaprenyl-diphosphate synthase subunit 1 OS=Mus musculus GN=Pdss1 PE=1 SV=1 75 445 7.0E-86
sp|Q54VJ9|DPS1_DICDI Decaprenyl-diphosphate synthase OS=Dictyostelium discoideum GN=coq1 PE=3 SV=1 98 445 2.0E-80
sp|Q653T6|SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=SPS1 PE=1 SV=1 75 445 3.0E-78
sp|Q5HZ00|SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SPS3 PE=1 SV=1 74 445 5.0E-70
sp|P72580|PREA_SYNY3 Prenyl transferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=preA PE=3 SV=2 80 436 2.0E-69
sp|Q9TLS1|PREA_CYACA Prenyl transferase OS=Cyanidium caldarium GN=preA PE=3 SV=1 76 445 4.0E-69
sp|P31171|PREA_CYAPA Prenyl transferase OS=Cyanophora paradoxa GN=preA PE=3 SV=1 80 443 3.0E-67
sp|Q0INZ4|SPS3_ORYSJ Probable solanesyl-diphosphate synthase 3, chloroplastic (Fragment) OS=Oryza sativa subsp. japonica GN=SPS3 PE=3 SV=1 28 443 3.0E-64
sp|P51268|PREA_PORPU Prenyl transferase OS=Porphyra purpurea GN=preA PE=3 SV=1 80 443 3.0E-63
sp|Q8S948|SPS1_ARATH Solanesyl diphosphate synthase 1 OS=Arabidopsis thaliana GN=SPS1 PE=1 SV=1 80 443 7.0E-62
sp|Q75HZ9|SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=SPS2 PE=1 SV=2 77 443 3.0E-61
sp|Q76FS5|SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=SPS2 PE=1 SV=1 77 443 1.0E-60
sp|Q1XDL8|PREA_PYRYE Prenyl transferase OS=Pyropia yezoensis GN=preA PE=3 SV=1 80 443 5.0E-59
sp|P44916|ISPB_HAEIN Octaprenyl-diphosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ispB PE=1 SV=1 70 443 3.0E-46
sp|P0AD58|ISPB_SHIFL Octaprenyl-diphosphate synthase OS=Shigella flexneri GN=ispB PE=3 SV=1 188 445 2.0E-42
sp|P0AD57|ISPB_ECOLI Octaprenyl-diphosphate synthase OS=Escherichia coli (strain K12) GN=ispB PE=1 SV=1 188 445 2.0E-42
sp|P55785|HEPS2_GEOSE Heptaprenyl diphosphate synthase component 2 OS=Geobacillus stearothermophilus GN=hepT PE=3 SV=1 90 443 2.0E-35
sp|P31114|HEPS2_BACSU Heptaprenyl diphosphate synthase component 2 OS=Bacillus subtilis (strain 168) GN=hepT PE=1 SV=1 83 444 4.0E-34
sp|O66129|HEXB_MICLU Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) OS=Micrococcus luteus GN=hexs-b PE=1 SV=1 187 443 2.0E-32
sp|O24743|SDSA_RHOCA All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) OS=Rhodobacter capsulatus GN=sdsA PE=1 SV=1 186 443 1.0E-30
sp|Q5U2R1|DLP1_RAT Decaprenyl-diphosphate synthase subunit 2 OS=Rattus norvegicus GN=Pdss2 PE=2 SV=1 75 433 2.0E-27
sp|Q33DR3|DLP1_MOUSE Decaprenyl-diphosphate synthase subunit 2 OS=Mus musculus GN=Pdss2 PE=1 SV=2 75 433 6.0E-27
sp|Q58270|IDSA_METJA Short chain isoprenyl diphosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=idsA PE=3 SV=1 179 424 2.0E-25
sp|Q86YH6|DLP1_HUMAN Decaprenyl-diphosphate synthase subunit 2 OS=Homo sapiens GN=PDSS2 PE=1 SV=2 75 433 1.0E-24
sp|Q53479|IDSA_METTM Short chain isoprenyl diphosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=idsA PE=1 SV=3 193 444 7.0E-24
sp|P80042|GGPPS_CAPAN Geranylgeranyl pyrophosphate synthase, chloroplastic OS=Capsicum annuum GN=GGPS1 PE=3 SV=1 192 403 6.0E-22
sp|Q94ID7|GGPPS_HEVBR Geranylgeranyl pyrophosphate synthase, chloroplastic OS=Hevea brasiliensis GN=GGPS PE=1 SV=1 192 445 1.0E-21
sp|O13851|DLP1_SCHPO Decaprenyl-diphosphate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dlp1 PE=1 SV=1 75 442 2.0E-21
sp|P95999|GGPS_SULSO Geranylgeranyl diphosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gds PE=3 SV=2 192 445 9.0E-21
sp|O26156|IDSA_METTH Short chain isoprenyl diphosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=idsA PE=3 SV=1 192 444 1.0E-20
sp|Q42698|GGPPS_CATRO Geranylgeranyl pyrophosphate synthase, chloroplastic OS=Catharanthus roseus GN=GGPS1 PE=3 SV=1 192 383 2.0E-19
sp|Q3IPL1|GFPS_NATPD Geranylfarnesyl diphosphate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=idsA3 PE=1 SV=1 106 443 5.0E-19
sp|Q9ZU77|GGPP7_ARATH Geranylgeranyl pyrophosphate synthase 7, chloroplastic OS=Arabidopsis thaliana GN=At2g18620 PE=2 SV=1 175 376 5.0E-19
sp|P48368|CRTE_CYAPA Geranylgeranyl diphosphate synthase OS=Cyanophora paradoxa GN=crtE PE=3 SV=1 193 372 9.0E-19
sp|Q9UWR6|GFPS_AERPX Geranylfarnesyl diphosphate synthase OS=Aeropyrum pernix GN=fgs PE=1 SV=1 188 445 2.0E-18
sp|P34802|GGPP1_ARATH Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic OS=Arabidopsis thaliana GN=GGPPS1 PE=1 SV=2 175 383 2.0E-18
sp|P39464|GGPS_SULAC Geranylgeranyl diphosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gds PE=1 SV=1 179 363 8.0E-18
sp|Q43133|GGPPS_SINAL Geranylgeranyl pyrophosphate synthase, chloroplastic/chromoplastic OS=Sinapis alba GN=GGPS1 PE=1 SV=1 192 416 8.0E-17
sp|P9WKH1|EFPP_MYCTU (2E,6E)-farnesyl diphosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3398c PE=1 SV=1 192 444 1.0E-16
sp|P9WKH0|EFPP_MYCTO (2E,6E)-farnesyl diphosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3506 PE=3 SV=1 192 444 1.0E-16
sp|P0A5H9|EFPP_MYCBO (2E,6E)-farnesyl diphosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3431c PE=3 SV=1 192 444 1.0E-16
sp|Q9LJY2|GGPPA_ARATH Geranylgeranyl pyrophosphate synthase 10, mitochondrial OS=Arabidopsis thaliana GN=At3g20160 PE=1 SV=1 193 403 2.0E-16
sp|Q08291|ISPA_GEOSE Farnesyl diphosphate synthase OS=Geobacillus stearothermophilus PE=1 SV=1 102 370 3.0E-16
sp|Q8PYS1|GFPS_METMA Geranylfarnesyl diphosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0789 PE=1 SV=1 100 344 5.0E-16
sp|Q9SLG2|GGPP4_ARATH Geranylgeranyl pyrophosphate synthase 4 OS=Arabidopsis thaliana GN=GGPP4 PE=2 SV=1 177 376 1.0E-15
sp|Q9LRR0|GGPP8_ARATH Putative geranylgeranyl pyrophosphate synthase 8, chloroplastic OS=Arabidopsis thaliana GN=At3g14510 PE=5 SV=2 192 383 1.0E-15
sp|O04046|GGPP2_ARATH Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 2 OS=Arabidopsis thaliana GN=GGPPS2 PE=1 SV=2 192 376 3.0E-15
sp|Q8PW34|GGPP_METMA Geranylgeranyl diphosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1767 PE=3 SV=1 176 444 8.0E-15
sp|O66126|ISPA_MICLU Farnesyl diphosphate synthase OS=Micrococcus luteus GN=fps PE=3 SV=1 193 358 5.0E-14
sp|Q9LUD9|GGPP3_ARATH Geranylgeranyl pyrophosphate synthase 3, chloroplastic OS=Arabidopsis thaliana GN=GGPP3 PE=1 SV=1 192 376 1.0E-12
sp|O22043|GGPP6_ARATH Geranylgeranyl pyrophosphate synthase 6, mitochondrial OS=Arabidopsis thaliana GN=GGPP6 PE=2 SV=2 175 383 1.0E-12
sp|Q9LIA0|GGPPB_ARATH Geranylgeranyl pyrophosphate synthase 11, chloroplastic OS=Arabidopsis thaliana GN=At3g29430 PE=2 SV=1 192 385 6.0E-12
sp|Q9LUE1|GGPP9_ARATH Geranylgeranyl pyrophosphate synthase 9, chloroplastic OS=Arabidopsis thaliana GN=GGPPS9 PE=1 SV=1 192 376 1.0E-11
sp|P22873|CRTE_ESCVU Geranylgeranyl diphosphate synthase OS=Escherichia vulneris GN=crtE PE=1 SV=1 182 354 2.0E-11
sp|P17060|CRTE_RHOCB Geranylgeranyl diphosphate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtE PE=3 SV=1 193 357 2.0E-10
sp|Q9LHR4|GGPPC_ARATH Geranylgeranyl pyrophosphate synthase 12, chloroplastic OS=Arabidopsis thaliana GN=At3g32040 PE=2 SV=1 192 385 2.0E-10
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 188 374 2.0E-09
sp|P54976|CRTE_RHOS4 Geranylgeranyl diphosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=crtE PE=3 SV=3 193 443 4.0E-09
sp|P21684|CRTE_PANAN Geranylgeranyl diphosphate synthase OS=Pantoea ananas GN=crtE PE=3 SV=1 188 354 7.0E-09
sp|P22939|ISPA_ECOLI Farnesyl diphosphate synthase OS=Escherichia coli (strain K12) GN=ispA PE=1 SV=1 189 372 9.0E-09
sp|P54383|ISPA_BACSU Farnesyl diphosphate synthase OS=Bacillus subtilis (strain 168) GN=ispA PE=3 SV=2 192 371 2.0E-08
sp|P55539|ISPA_RHISN Probable farnesyl diphosphate synthase OS=Rhizobium sp. (strain NGR234) GN=NGR_a02750 PE=3 SV=1 193 387 4.0E-08
sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 188 441 4.0E-07
sp|P57537|ISPA_BUCAI Farnesyl diphosphate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ispA PE=3 SV=1 193 344 4.0E-07
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 188 411 6.0E-07
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 188 432 1.0E-06
sp|Q8K9A0|ISPA_BUCAP Farnesyl diphosphate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ispA PE=3 SV=1 192 341 1.0E-06
sp|P45204|ISPA_HAEIN Farnesyl diphosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ispA PE=3 SV=1 199 375 1.0E-06
sp|Q39108|GGR_ARATH Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic OS=Arabidopsis thaliana GN=GGR PE=1 SV=2 153 354 2.0E-06
sp|Q758K0|GGPPS_ASHGO Geranylgeranyl pyrophosphate synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTS1 PE=3 SV=1 184 367 2.0E-06
sp|Q6F596|GGPPS_RAT Geranylgeranyl pyrophosphate synthase OS=Rattus norvegicus GN=Ggps1 PE=2 SV=1 188 422 4.0E-06
sp|O95749|GGPPS_HUMAN Geranylgeranyl pyrophosphate synthase OS=Homo sapiens GN=GGPS1 PE=1 SV=1 188 421 5.0E-06
sp|P56966|GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus GN=GGPS1 PE=1 SV=2 188 421 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008299 isoprenoid biosynthetic process Yes
GO:0006629 lipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006720 isoprenoid metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3721
MQTRGHCAALLRKAVAYRSSALGAQAHGPCALPTPRHSGLHTSPQCSSAWAAAIQVAAKMAGNVVKHANDGMTID
PLRTVAKEMQLLTGDMRKLLTSAHPSLDRVAKYYLQSQGKHVRPLIVLLMSRATHVCPKNSQHNALHSASAIDTS
ISPVQILADANPSVLCQSIKDPEPGNARSEILPAQRRLAEITELIHTASLLHDDVIDRSESRRGSASANFEFGSK
MAVLAGDFMLARASVALARLRHLEVVELMSTVIANLVEGEFMQLKNTARDEPSPEWSEETLAYYIHKTYLKTASL
LSKSCRASALLGNVDGPTVEAAYGFGRNIGLAFQLVDDMLDYTQSGHHLGKPAGADLKLGLATAPLLFAWKQKPE
LGALVGRKFAVEGDVERAYDLVLQSDGIEQTRALARDYAAKAVAAISGFPDSEAKDGLVEMARRTAERQK*
Coding >OphauG2|3721
ATGCAGACCCGTGGACATTGTGCGGCACTGTTGCGCAAGGCTGTTGCTTACAGGAGCTCGGCACTAGGCGCCCAA
GCCCATGGACCTTGTGCGCTGCCCACACCACGACACAGCGGCCTGCACACGTCGCCGCAATGCTCCTCGGCCTGG
GCTGCGGCTATCCAGGTGGCGGCCAAGATGGCTGGCAATGTGGTCAAGCACGCCAACGATGGCATGACGATTGAT
CCGCTGCGCACCGTGGCCAAGGAGATGCAGCTCCTCACGGGCGACATGCGCAAGCTGCTCACCTCTGCTCACCCG
TCGCTCGACAGGGTGGCCAAGTACTACTTGCAGAGCCAGGGCAAACACGTGCGGCCGCTCATTGTGCTACTCATG
AGCCGTGCAACCCATGTGTGCCCCAAGAATTCGCAGCACAATGCGTTGCACAGCGCGTCAGCCATCGACACGTCA
ATATCACCCGTGCAGATCCTCGCAGACGCCAACCCGTCAGTCCTGTGCCAAAGCATCAAGGATCCCGAGCCAGGC
AATGCCCGCTCTGAAATCCTGCCTGCTCAGCGGCGCCTTGCCGAGATTACAGAGCTGATCCATACTGCCTCGCTG
CTACACGACGACGTCATTGACCGCTCTGAATCAAGACGCGGCTCAGCGTCGGCCAATTTTGAGTTTGGTAGTAAA
ATGGCCGTCCTCGCTGGCGACTTCATGCTGGCCCGTGCCTCGGTTGCTCTGGCGCGGTTACGGCATCTCGAGGTG
GTGGAGTTGATGTCGACCGTCATTGCAAACCTGGTGGAGGGAGAGTTTATGCAGCTCAAAAACACTGCGCGTGAC
GAGCCCAGCCCTGAATGGTCCGAAGAGACGCTCGCCTACTATATTCACAAGACATACCTCAAGACTGCAAGCCTC
TTGTCCAAGTCTTGCCGCGCCTCGGCTCTGCTTGGCAATGTTGATGGCCCCACGGTCGAGGCAGCCTACGGGTTT
GGGAGGAATATAGGGCTTGCTTTCCAGCTTGTGGACGACATGCTTGACTACACCCAGAGTGGCCATCATCTGGGC
AAGCCTGCCGGAGCGGACCTCAAGTTGGGCCTGGCAACGGCGCCGCTGCTGTTTGCGTGGAAGCAGAAGCCGGAA
TTGGGTGCGCTGGTAGGTCGCAAGTTTGCGGTAGAGGGCGACGTTGAAAGGGCATACGACCTCGTGCTCCAAAGC
GACGGCATCGAGCAGACGCGGGCACTAGCTCGGGACTACGCTGCCAAGGCAGTCGCTGCCATTTCCGGATTTCCA
GACAGCGAGGCTAAAGACGGGCTGGTGGAGATGGCGCGCAGGACAGCCGAGAGGCAAAAGTAG
Transcript >OphauG2|3721
ATGCAGACCCGTGGACATTGTGCGGCACTGTTGCGCAAGGCTGTTGCTTACAGGAGCTCGGCACTAGGCGCCCAA
GCCCATGGACCTTGTGCGCTGCCCACACCACGACACAGCGGCCTGCACACGTCGCCGCAATGCTCCTCGGCCTGG
GCTGCGGCTATCCAGGTGGCGGCCAAGATGGCTGGCAATGTGGTCAAGCACGCCAACGATGGCATGACGATTGAT
CCGCTGCGCACCGTGGCCAAGGAGATGCAGCTCCTCACGGGCGACATGCGCAAGCTGCTCACCTCTGCTCACCCG
TCGCTCGACAGGGTGGCCAAGTACTACTTGCAGAGCCAGGGCAAACACGTGCGGCCGCTCATTGTGCTACTCATG
AGCCGTGCAACCCATGTGTGCCCCAAGAATTCGCAGCACAATGCGTTGCACAGCGCGTCAGCCATCGACACGTCA
ATATCACCCGTGCAGATCCTCGCAGACGCCAACCCGTCAGTCCTGTGCCAAAGCATCAAGGATCCCGAGCCAGGC
AATGCCCGCTCTGAAATCCTGCCTGCTCAGCGGCGCCTTGCCGAGATTACAGAGCTGATCCATACTGCCTCGCTG
CTACACGACGACGTCATTGACCGCTCTGAATCAAGACGCGGCTCAGCGTCGGCCAATTTTGAGTTTGGTAGTAAA
ATGGCCGTCCTCGCTGGCGACTTCATGCTGGCCCGTGCCTCGGTTGCTCTGGCGCGGTTACGGCATCTCGAGGTG
GTGGAGTTGATGTCGACCGTCATTGCAAACCTGGTGGAGGGAGAGTTTATGCAGCTCAAAAACACTGCGCGTGAC
GAGCCCAGCCCTGAATGGTCCGAAGAGACGCTCGCCTACTATATTCACAAGACATACCTCAAGACTGCAAGCCTC
TTGTCCAAGTCTTGCCGCGCCTCGGCTCTGCTTGGCAATGTTGATGGCCCCACGGTCGAGGCAGCCTACGGGTTT
GGGAGGAATATAGGGCTTGCTTTCCAGCTTGTGGACGACATGCTTGACTACACCCAGAGTGGCCATCATCTGGGC
AAGCCTGCCGGAGCGGACCTCAAGTTGGGCCTGGCAACGGCGCCGCTGCTGTTTGCGTGGAAGCAGAAGCCGGAA
TTGGGTGCGCTGGTAGGTCGCAAGTTTGCGGTAGAGGGCGACGTTGAAAGGGCATACGACCTCGTGCTCCAAAGC
GACGGCATCGAGCAGACGCGGGCACTAGCTCGGGACTACGCTGCCAAGGCAGTCGCTGCCATTTCCGGATTTCCA
GACAGCGAGGCTAAAGACGGGCTGGTGGAGATGGCGCGCAGGACAGCCGAGAGGCAAAAGTAG
Gene >OphauG2|3721
ATGCAGACCCGTGGACATTGTGCGGCACTGTTGCGCAAGGCTGTTGCTTACAGGAGCTCGGCACTAGGCGCCCAA
GCCCATGGACCTTGTGCGCTGCCCACACCACGACACAGCGGCCTGCACACGTCGCCGCAATGCTCCTCGGCCTGG
GCTGCGGCTATCCAGGTGGCGGCCAAGATGGCTGGCAATGTGGTCAAGCACGCCAACGATGGCATGACGATTGAT
CCGCTGCGCACCGTGGCCAAGGAGATGCAGCTCCTCACGGGCGACATGCGCAAGCTGCTCACCTCTGCTCACCCG
TCGCTCGACAGGGTGGCCAAGTACTACTTGCAGAGCCAGGGCAAACACGTGCGGCCGCTCATTGTGCTACTCATG
AGCCGTGCAACCCATGTGTGCCCCAAGAATTCGCAGCACAATGCGTTGCACAGCGCGTCAGCCATCGACACGTCA
ATATCACCCGTGCAGATCCTCGCAGACGCCAACCCGTCAGTCCTGTGCCAAAGCATCAAGGATCCCGAGCCAGGC
AATGCCCGCTCTGAAATCCTGCCTGCTCAGCGGCGCCTTGCCGAGATTACAGAGCTGATCCATACTGCCTCGCTG
CTACACGACGACGTCATTGACCGCTCTGAATCAAGACGCGGCTCAGCGTCGGCCAATTTTGAGTTTGGTAGTAAA
ATGGCCGTCCTCGCTGGCGACTTCATGCTGGCCCGTGCCTCGGTTGCTCTGGCGCGGTTACGGCATCTCGAGGTG
GTGGAGTTGATGTCGACCGTCATTGCAAACCTGGTGGAGGGAGAGTTTATGCAGCTCAAAAACACTGCGCGTGAC
GAGCCCAGCCCTGAATGGTCCGAAGAGACGCTCGCCTACTATATTCACAAGACATACCTCAAGACTGCAAGCCTC
TTGTCCAAGTCTTGCCGCGCCTCGGCTCTGCTTGGCAATGTTGATGGCCCCACGGTCGAGGCAGCCTACGGGTTT
GGGAGGAATATAGGGCTTGCTTTCCAGCTTGTGGACGACATGCTTGACTACACCCAGAGTGGCCATCATCTGGGC
AAGCCTGCCGGAGCGGACCTCAAGTTGGGCCTGGCAACGGCGCCGCTGCTGTTTGCGTGGAAGCAGAAGCCGGAA
TTGGGTGCGCTGGTAGGTCGCAAGTTTGCGGTAGAGGGCGACGTTGAAAGGGTAAGCCACACGACAAGTGCACTG
CACAAATGACGGTGGATGGTGGCCTTGTATCCCCATGGCAACTAGCTGATGGCTGCAACAGGCATACGACCTCGT
GCTCCAAAGCGACGGCATCGAGCAGACGCGGGCACTAGCTCGGGACTACGCTGCCAAGGCAGTCGCTGCCATTTC
CGGATTTCCAGACAGCGAGGCTAAAGACGGGCTGGTGGAGATGGCGCGCAGGACAGCCGAGAGGCAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail