Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|370
Gene name
LocationContig_1084:424..2267
Strand+
Gene length (bp)1843
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08386 Abhydrolase_4 TAP-like protein 6.6E-17 442 553
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.0E-14 90 529

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 51 553 2.0E-26
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 51 553 2.0E-26
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 51 553 2.0E-26
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 26 553 2.0E-20
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 26 553 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 51 553 2.0E-26
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 51 553 2.0E-26
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 51 553 2.0E-26
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 26 553 2.0E-20
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 26 553 2.0E-20
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 26 553 2.0E-20
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 40 559 6.0E-20
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 40 559 1.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|370
MLSSLLLLLLASLSIRLAAADDDELPQFNWTSITPARDLEYHDCYNSQFKCARLLLPINWLDANDTRTTAIAIIK
VPATVPESDASFGGAVFTNPGGPGASGVEFVLLDGRNMQHRLSRNQNYEIISFDPRGVGNSTPQSICFDEQLARD
AMVLQMLGSGGLNSGLATVRYTHALIKSYSDVCERSDAKTGPIMGFAGTASVARDLVEMVDKTDELRAREGNGRG
GGKARLQYIGFSYGTILGNYFTSLYPGRVGRVILDGVADADDYSSRLGWLTNLQDADAIFDQFFEGCFRAPPSAC
PLKQANDSSAAVIKARVTSYLSSLDTLPLAVMGRDNVRVITGDYVRRMIGDAFKFPIYEFRPLATMLAQAMAGNA
SALVTAFTAASVPKLKRSVGVGRSIPPYTQINEASQAVLCSDGQDVRDVSVAQWQTYIARQVQTSRIYGAYWSEL
RFACSSWPFVSNWRFTGPFGSPSPDAGLKDDRPAAPLLFLSNRLDPVTPLASARRMAAGHPGSGLAILEDMAHTV
FIQNNSCIDGIIHDYLELGIVPAQEKLCNASCGPWEDCPIERLHLY*
Coding >OphauG2|370
ATGCTCTCCTCGCTGCTGCTGCTGCTGCTCGCCTCGCTCAGCATCCGCCTCGCAGCAGCAGACGACGACGAGCTG
CCGCAGTTCAACTGGACAAGCATTACGCCCGCCCGCGATCTCGAGTACCACGACTGCTACAACAGCCAGTTCAAG
TGTGCGCGGCTGCTGCTGCCCATCAACTGGCTCGACGCCAACGACACGCGCACCACGGCCATTGCCATCATCAAG
GTGCCGGCCACGGTGCCCGAGAGCGATGCCTCGTTTGGCGGCGCCGTCTTCACCAACCCAGGCGGGCCGGGCGCG
TCGGGCGTCGAGTTTGTGCTGCTCGACGGCCGCAACATGCAGCACCGCCTGAGCCGCAACCAGAACTATGAAATC
ATCTCGTTTGACCCGCGCGGCGTGGGAAACAGCACGCCGCAGTCGATTTGCTTCGACGAGCAGCTGGCGCGCGAC
GCCATGGTGCTGCAGATGCTGGGCTCGGGGGGGTTGAATTCGGGATTGGCAACGGTGCGGTATACACATGCTCTG
ATCAAGTCGTATAGCGATGTGTGTGAGCGCAGCGATGCCAAGACGGGGCCGATTATGGGCTTTGCGGGAACGGCG
TCGGTGGCGCGCGACTTGGTGGAAATGGTGGACAAGACGGATGAGCTGCGTGCGCGAGAGGGCAATGGCAGAGGC
GGCGGCAAGGCCAGGCTGCAGTATATTGGCTTTTCGTACGGCACGATTCTGGGAAACTACTTTACGTCGCTGTAT
CCAGGGCGAGTGGGACGAGTGATTCTGGATGGAGTGGCGGATGCAGATGATTATTCTAGCCGTCTGGGCTGGCTC
ACAAATCTTCAAGACGCAGATGCCATCTTTGACCAATTCTTCGAGGGCTGCTTCCGCGCCCCCCCATCCGCCTGT
CCCCTCAAGCAAGCCAACGACAGCAGCGCCGCCGTCATCAAGGCCCGCGTGACGTCGTACCTCTCCAGCCTCGAC
ACGCTCCCCCTCGCCGTCATGGGGCGCGACAATGTGCGCGTCATCACCGGCGACTACGTCCGGCGCATGATTGGC
GACGCCTTCAAGTTCCCCATCTACGAATTCCGCCCGCTGGCCACGATGCTCGCCCAAGCCATGGCCGGCAACGCC
TCGGCCCTCGTCACCGCCTTTACCGCCGCCAGCGTCCCCAAGCTCAAGCGCAGCGTCGGCGTCGGCCGCTCCATC
CCGCCATACACCCAGATCAACGAGGCGTCGCAGGCCGTCCTCTGCAGCGACGGCCAAGACGTGCGCGACGTGAGT
GTGGCGCAGTGGCAGACCTACATCGCCAGACAGGTCCAGACGTCGAGAATCTACGGCGCGTACTGGTCGGAGCTG
CGCTTTGCGTGCTCCTCGTGGCCCTTTGTGTCCAACTGGCGCTTCACGGGGCCCTTTGGCTCGCCCTCGCCAGAT
GCGGGCCTCAAGGACGACAGGCCCGCCGCGCCGTTGTTGTTTTTGTCGAACCGCCTGGATCCTGTGACGCCCTTG
GCTTCGGCCCGGCGCATGGCGGCAGGCCATCCGGGCTCGGGGCTGGCCATCTTGGAGGACATGGCGCATACCGTC
TTTATCCAGAATAATTCATGCATTGACGGCATCATTCACGATTATCTCGAGCTGGGCATTGTTCCGGCGCAGGAG
AAGCTGTGTAATGCGTCGTGCGGGCCGTGGGAGGACTGTCCAATAGAGCGTCTACATTTGTATTGA
Transcript >OphauG2|370
ATGCTCTCCTCGCTGCTGCTGCTGCTGCTCGCCTCGCTCAGCATCCGCCTCGCAGCAGCAGACGACGACGAGCTG
CCGCAGTTCAACTGGACAAGCATTACGCCCGCCCGCGATCTCGAGTACCACGACTGCTACAACAGCCAGTTCAAG
TGTGCGCGGCTGCTGCTGCCCATCAACTGGCTCGACGCCAACGACACGCGCACCACGGCCATTGCCATCATCAAG
GTGCCGGCCACGGTGCCCGAGAGCGATGCCTCGTTTGGCGGCGCCGTCTTCACCAACCCAGGCGGGCCGGGCGCG
TCGGGCGTCGAGTTTGTGCTGCTCGACGGCCGCAACATGCAGCACCGCCTGAGCCGCAACCAGAACTATGAAATC
ATCTCGTTTGACCCGCGCGGCGTGGGAAACAGCACGCCGCAGTCGATTTGCTTCGACGAGCAGCTGGCGCGCGAC
GCCATGGTGCTGCAGATGCTGGGCTCGGGGGGGTTGAATTCGGGATTGGCAACGGTGCGGTATACACATGCTCTG
ATCAAGTCGTATAGCGATGTGTGTGAGCGCAGCGATGCCAAGACGGGGCCGATTATGGGCTTTGCGGGAACGGCG
TCGGTGGCGCGCGACTTGGTGGAAATGGTGGACAAGACGGATGAGCTGCGTGCGCGAGAGGGCAATGGCAGAGGC
GGCGGCAAGGCCAGGCTGCAGTATATTGGCTTTTCGTACGGCACGATTCTGGGAAACTACTTTACGTCGCTGTAT
CCAGGGCGAGTGGGACGAGTGATTCTGGATGGAGTGGCGGATGCAGATGATTATTCTAGCCGTCTGGGCTGGCTC
ACAAATCTTCAAGACGCAGATGCCATCTTTGACCAATTCTTCGAGGGCTGCTTCCGCGCCCCCCCATCCGCCTGT
CCCCTCAAGCAAGCCAACGACAGCAGCGCCGCCGTCATCAAGGCCCGCGTGACGTCGTACCTCTCCAGCCTCGAC
ACGCTCCCCCTCGCCGTCATGGGGCGCGACAATGTGCGCGTCATCACCGGCGACTACGTCCGGCGCATGATTGGC
GACGCCTTCAAGTTCCCCATCTACGAATTCCGCCCGCTGGCCACGATGCTCGCCCAAGCCATGGCCGGCAACGCC
TCGGCCCTCGTCACCGCCTTTACCGCCGCCAGCGTCCCCAAGCTCAAGCGCAGCGTCGGCGTCGGCCGCTCCATC
CCGCCATACACCCAGATCAACGAGGCGTCGCAGGCCGTCCTCTGCAGCGACGGCCAAGACGTGCGCGACGTGAGT
GTGGCGCAGTGGCAGACCTACATCGCCAGACAGGTCCAGACGTCGAGAATCTACGGCGCGTACTGGTCGGAGCTG
CGCTTTGCGTGCTCCTCGTGGCCCTTTGTGTCCAACTGGCGCTTCACGGGGCCCTTTGGCTCGCCCTCGCCAGAT
GCGGGCCTCAAGGACGACAGGCCCGCCGCGCCGTTGTTGTTTTTGTCGAACCGCCTGGATCCTGTGACGCCCTTG
GCTTCGGCCCGGCGCATGGCGGCAGGCCATCCGGGCTCGGGGCTGGCCATCTTGGAGGACATGGCGCATACCGTC
TTTATCCAGAATAATTCATGCATTGACGGCATCATTCACGATTATCTCGAGCTGGGCATTGTTCCGGCGCAGGAG
AAGCTGTGTAATGCGTCGTGCGGGCCGTGGGAGGACTGTCCAATAGAGCGTCTACATTTGTATTGA
Gene >OphauG2|370
ATGCTCTCCTCGCTGCTGCTGCTGCTGCTCGCCTCGCTCAGCATCCGCCTCGCAGCAGCAGACGACGACGAGCTG
CCGCAGTTCAACTGGACAAGCATTACGCCCGCCCGCGATCTCGAGTACCACGACTGCTACAACAGCCAGTTCAAG
TGTGCGCGGCTGCTGCTGCCCATCAACTGGCTCGACGCCAACGACACGCGCACCACGGCCATTGCCATCATCAAG
GTGCCGGCCACGGTGCCCGAGAGCGATGCCTCGTTTGGCGGCGCCGTCTTCACCAACCCAGGCGGGCCGGGCGCG
TCGGGCGTCGAGTTTGTGCTGCTCGACGGCCGCAACATGCAGCACCGCCTGAGCCGCAACCAGAACTATGAAATC
ATCTCGTTTGACCCGCGCGGCGTGGGAAACAGCACGCCGCAGTCGATTTGCTTCGACGAGCAGCTGGCGCGCGAC
GCCATGGTGCTGCAGATGCTGGGCTCGGGGGGGTTGAATTCGGGATTGGCAACGGTGCGGTATACACATGCTCTG
ATCAAGTCGTATAGCGATGTGTGTGAGCGCAGCGATGCCAAGACGGGGCCGATTATGGGCTTTGCGGGAACGGCG
TCGGTGGCGCGCGACTTGGTGGAAATGGTGGACAAGACGGATGAGCTGCGTGCGCGAGAGGGCAATGGCAGAGGC
GGCGGCAAGGCCAGGCTGCAGTATATTGGCTTTTCGTACGGCACGATTCTGGGAAACTACTTTACGTCGCTGTAT
CCAGGGCGAGTGGGACGAGTGATTCTGGATGGAGTGGCGGATGCAGATGATTATTCTAGCCGTCTGGTAAGAGCT
GCAGTCATTGACCCCTGTTTTGCCCCTGTTTTGACACTTTTTTTTTCCAACTTTATTCACAATCATTCAACTTCT
CCATCACTAGAGTCGGTCTCTATCAGTAGCTAACTCTACATAGGGCTGGCTCACAAATCTTCAAGACGCAGATGC
CATCTTTGACCAATTCTTCGAGGGCTGCTTCCGCGCCCCCCCATCCGCCTGTCCCCTCAAGCAAGCCAACGACAG
CAGCGCCGCCGTCATCAAGGCCCGCGTGACGTCGTACCTCTCCAGCCTCGACACGCTCCCCCTCGCCGTCATGGG
GCGCGACAATGTGCGCGTCATCACCGGCGACTACGTCCGGCGCATGATTGGCGACGCCTTCAAGTTCCCCATCTA
CGAATTCCGCCCGCTGGCCACGATGCTCGCCCAAGCCATGGCCGGCAACGCCTCGGCCCTCGTCACCGCCTTTAC
CGCCGCCAGCGTCCCCAAGCTCAAGCGCAGCGTCGGCGTCGGCCGCTCCATCCCGCCATACACCCAGATCAACGA
GGCGTCGCAGGCCGTCCTCTGCAGCGACGGCCAAGACGTGCGCGACGTGAGTGTGGCGCAGTGGCAGACCTACAT
CGCCAGACAGGTCCAGACGTCGAGAATCTACGGCGCGTACTGGTCGGAGCTGCGCTTTGCGTGCTCCTCGTGGCC
CTTTGTGTCCAACTGGCGCTTCACGGGGCCCTTTGGCTCGCCCTCGCCAGATGCGGGCCTCAAGGACGACAGGCC
CGCCGCGCCGTTGTTGTTTTTGTCGAACCGCCTGGATCCTGTGACGCCCTTGGCTTCGGCCCGGCGCATGGCGGC
AGGCCATCCGGGCTCGGGGCTGGCCATCTTGGAGGACATGGCGCATACCGTCTTTATCCAGAATAATTCATGCAT
TGACGGCATCATTCACGATTATCTCGAGCTGGGCATTGTTCCGGCGCAGGAGAAGCTGTGTAATGCGTCGTGCGG
GCCGTGGGAGGACTGTCCAATAGAGCGTCTACATTTGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail