Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3691
Gene name
LocationContig_288:919..2005
Strand-
Gene length (bp)1086
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04968 CHORD CHORD 3.6E-23 4 61
PF04968 CHORD CHORD 1.5E-25 129 188
PF04969 CS CS domain 6.8E-10 214 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCC0|CHRD1_DROME Cysteine and histidine-rich domain-containing protein OS=Drosophila melanogaster GN=CHORD PE=1 SV=1 3 302 9.0E-50
sp|Q9D1P4|CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus GN=Chordc1 PE=1 SV=1 1 301 6.0E-47
sp|Q6NUA0|CHRD1_XENLA Cysteine and histidine-rich domain-containing protein 1 OS=Xenopus laevis GN=chordc1 PE=2 SV=1 1 301 8.0E-47
sp|Q7T3F7|CHRD1_DANRE Cysteine and histidine-rich domain-containing protein 1 OS=Danio rerio GN=chordc1 PE=2 SV=1 1 301 3.0E-46
sp|Q29RL2|CHRD1_BOVIN Cysteine and histidine-rich domain-containing protein 1 OS=Bos taurus GN=CHORDC1 PE=2 SV=1 1 301 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCC0|CHRD1_DROME Cysteine and histidine-rich domain-containing protein OS=Drosophila melanogaster GN=CHORD PE=1 SV=1 3 302 9.0E-50
sp|Q9D1P4|CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus GN=Chordc1 PE=1 SV=1 1 301 6.0E-47
sp|Q6NUA0|CHRD1_XENLA Cysteine and histidine-rich domain-containing protein 1 OS=Xenopus laevis GN=chordc1 PE=2 SV=1 1 301 8.0E-47
sp|Q7T3F7|CHRD1_DANRE Cysteine and histidine-rich domain-containing protein 1 OS=Danio rerio GN=chordc1 PE=2 SV=1 1 301 3.0E-46
sp|Q29RL2|CHRD1_BOVIN Cysteine and histidine-rich domain-containing protein 1 OS=Bos taurus GN=CHORDC1 PE=2 SV=1 1 301 3.0E-46
sp|Q9UHD1|CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens GN=CHORDC1 PE=1 SV=2 1 301 3.0E-46
sp|D4A4T9|CHRD1_RAT Cysteine and histidine-rich domain-containing protein 1 OS=Rattus norvegicus GN=Chordc1 PE=3 SV=1 1 301 3.0E-46
sp|Q5RD91|CHRD1_PONAB Cysteine and histidine-rich domain-containing protein 1 OS=Pongo abelii GN=CHORDC1 PE=2 SV=1 1 301 7.0E-46
sp|Q4R7U2|CHRD1_MACFA Cysteine and histidine-rich domain-containing protein 1 OS=Macaca fascicularis GN=CHORDC1 PE=2 SV=1 1 301 1.0E-45
sp|A9YUB1|CHRD1_PIG Cysteine and histidine-rich domain-containing protein 1 OS=Sus scrofa GN=CHORDC1 PE=2 SV=1 1 301 1.0E-45
sp|Q5ZML4|CHRD1_CHICK Cysteine and histidine-rich domain-containing protein 1 OS=Gallus gallus GN=CHORDC1 PE=2 SV=1 1 301 2.0E-44
sp|Q9R000|ITBP2_MOUSE Integrin beta-1-binding protein 2 OS=Mus musculus GN=Itgb1bp2 PE=1 SV=1 1 308 7.0E-39
sp|Q462R2|ITBP2_PIG Integrin beta-1-binding protein 2 OS=Sus scrofa GN=ITGB1BP2 PE=2 SV=1 1 308 2.0E-37
sp|Q9UKP3|ITBP2_HUMAN Integrin beta-1-binding protein 2 OS=Homo sapiens GN=ITGB1BP2 PE=1 SV=1 1 308 3.0E-37
sp|Q6EPW7|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica GN=RAR1 PE=1 SV=2 4 185 8.0E-22
sp|Q9SE33|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana GN=RAR1 PE=1 SV=1 4 185 8.0E-19
sp|Q9SE33|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana GN=RAR1 PE=1 SV=1 3 67 4.0E-15
sp|Q6EPW7|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica GN=RAR1 PE=1 SV=2 5 62 1.0E-13
sp|Q6EPW7|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica GN=RAR1 PE=1 SV=2 130 187 2.0E-10
sp|Q9SE33|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana GN=RAR1 PE=1 SV=1 130 187 8.0E-10
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 215 304 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3273
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3691 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2234
Ophiocordyceps camponoti-floridani Ophcf2|04526
Ophiocordyceps camponoti-rufipedis Ophun1|3284
Ophiocordyceps kimflemingae Ophio5|5067
Ophiocordyceps subramaniannii Hirsu2|5978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3691
MSQKCVHQGCGKLFTDSEDECHYHPGPPVFHEGQKGWKCCKPRVLTFDEFMAIPPCTSGTHSTTDKPPQIEERRA
EDSETLAKKIEALATAAVPRRTPIQPAQQSPTATLEAPETEDDDASLEIPHGTGCRRRSCNAKFNKDSSREGEEC
VYHPGVPIFHEGSKGYSCCKRRVLEFDQFLKIQGCKTRDRHLFIGKGLQKGKSAPQDQQVVDAVRHDFYQTTTKV
IASFFLKKIDQHVSTVKFEDKRLVLDLTTGDVPPKRYAAVVPLYGHIDTQKSMHKVLGTKLEVTLVKADGASWPV
LRSDEAVTGEILQVGRAGCA*
Coding >OphauG2|3691
ATGTCGCAAAAGTGCGTCCACCAAGGCTGCGGCAAGCTGTTCACTGACTCGGAGGATGAGTGCCATTACCATCCG
GGACCTCCCGTCTTCCACGAAGGACAGAAGGGCTGGAAATGTTGCAAGCCTCGAGTCTTGACTTTCGACGAGTTC
ATGGCCATTCCGCCCTGTACTTCAGGCACCCACTCAACAACAGACAAGCCTCCTCAGATAGAAGAGAGACGTGCG
GAGGATAGCGAAACTTTGGCTAAAAAGATTGAAGCCCTTGCGACAGCCGCAGTGCCTCGGCGAACACCGATCCAA
CCTGCACAGCAAAGTCCCACAGCAACACTGGAGGCGCCTGAGACAGAAGACGACGATGCAAGCCTCGAGATCCCC
CATGGCACTGGGTGCCGTCGGAGAAGCTGTAATGCCAAGTTCAACAAGGACAGCTCTCGCGAGGGTGAAGAGTGT
GTGTACCATCCCGGCGTGCCCATCTTTCACGAGGGCAGCAAGGGATATTCGTGCTGTAAACGGCGCGTTCTCGAA
TTCGACCAATTTCTCAAGATTCAGGGCTGCAAAACCAGGGATAGACACCTCTTTATTGGAAAGGGGTTGCAAAAG
GGCAAAAGCGCGCCACAAGACCAACAAGTCGTGGATGCTGTTAGACACGACTTTTACCAGACAACGACCAAGGTT
ATTGCGTCATTCTTCCTCAAAAAGATTGACCAGCATGTTTCCACGGTCAAATTTGAAGACAAGCGGCTCGTGCTT
GACTTGACGACGGGCGACGTGCCGCCCAAGCGTTATGCTGCCGTGGTGCCTTTGTATGGGCACATTGACACGCAA
AAGTCGATGCACAAGGTGCTAGGTACCAAGCTCGAGGTGACGCTGGTCAAGGCTGATGGGGCTTCTTGGCCGGTG
CTACGCAGTGACGAAGCAGTGACGGGTGAAATTCTGCAGGTTGGGCGGGCTGGTTGCGCGTAG
Transcript >OphauG2|3691
ATGTCGCAAAAGTGCGTCCACCAAGGCTGCGGCAAGCTGTTCACTGACTCGGAGGATGAGTGCCATTACCATCCG
GGACCTCCCGTCTTCCACGAAGGACAGAAGGGCTGGAAATGTTGCAAGCCTCGAGTCTTGACTTTCGACGAGTTC
ATGGCCATTCCGCCCTGTACTTCAGGCACCCACTCAACAACAGACAAGCCTCCTCAGATAGAAGAGAGACGTGCG
GAGGATAGCGAAACTTTGGCTAAAAAGATTGAAGCCCTTGCGACAGCCGCAGTGCCTCGGCGAACACCGATCCAA
CCTGCACAGCAAAGTCCCACAGCAACACTGGAGGCGCCTGAGACAGAAGACGACGATGCAAGCCTCGAGATCCCC
CATGGCACTGGGTGCCGTCGGAGAAGCTGTAATGCCAAGTTCAACAAGGACAGCTCTCGCGAGGGTGAAGAGTGT
GTGTACCATCCCGGCGTGCCCATCTTTCACGAGGGCAGCAAGGGATATTCGTGCTGTAAACGGCGCGTTCTCGAA
TTCGACCAATTTCTCAAGATTCAGGGCTGCAAAACCAGGGATAGACACCTCTTTATTGGAAAGGGGTTGCAAAAG
GGCAAAAGCGCGCCACAAGACCAACAAGTCGTGGATGCTGTTAGACACGACTTTTACCAGACAACGACCAAGGTT
ATTGCGTCATTCTTCCTCAAAAAGATTGACCAGCATGTTTCCACGGTCAAATTTGAAGACAAGCGGCTCGTGCTT
GACTTGACGACGGGCGACGTGCCGCCCAAGCGTTATGCTGCCGTGGTGCCTTTGTATGGGCACATTGACACGCAA
AAGTCGATGCACAAGGTGCTAGGTACCAAGCTCGAGGTGACGCTGGTCAAGGCTGATGGGGCTTCTTGGCCGGTG
CTACGCAGTGACGAAGCAGTGACGGGTGAAATTCTGCAGGTTGGGCGGGCTGGTTGCGCGTAG
Gene >OphauG2|3691
ATGTCGCAAAAGTGCGTCCACCAAGGCTGCGGCAAGCTGTTCACTGACTCGGAGGATGAGTGCCATTACCATCCG
GGACCTCCCGTCTTCCACGAAGGACAGAAGGGTAAGCGATAGCTTTGAGATTTTGGTAGCATCCTGCTGAGTGTA
CTTTGTTTTGGCAGGCTGGAAATGTTGCAAGCCTCGAGTCTTGACTTTCGACGAGTTCATGGCCATTCCGCCCTG
TACTTCAGGCACCCACTCAACAACAGACAAGCCTCCTCAGATAGAAGAGAGACGTGCGGAGGATAGCGAAACTTT
GGCTAAAAAGATTGAAGCCCTTGCGACAGCCGCAGTGCCTCGGCGAACACCGATCCAACCTGCACAGCAAAGTCC
CACAGCAACACTGGAGGCGCCTGAGACAGAAGACGACGATGCAAGCCTCGAGATCCCCCATGGCACTGGGTGCCG
TCGGAGAAGCTGTAATGCCAAGTTCAACAAGGACAGCTCTCGCGAGGGTGAAGAGTGTGTGTACCATCCCGGCGT
GCCCATCTTTCACGAGGGCAGCAAGGGATATTCGTGCTGTAAACGGCGCGTTCTCGAATTCGACCAATTTCTCAA
GATTCAGGGCTGCAAAACCAGGGATAGACACCTCTTTATTGGAAAGGGGTTGCAAAAGGGCAAAAGCGCGCCACA
AGACCAACAAGTCGTGGATGCTGTTAGGTGAGGAGCCAGGCTGTTATTGTGGCGTGTAGATGGAGAGATGGCGCT
TACAGAGATATGGGCAGACACGACTTTTACCAGACAACGACCAAGGTTATTGCGTCATTCTTCCTCAAAAAGATT
GACCAGCATGTTTCCACGGTCAAATTTGAAGACAAGCGGCTCGTGCTTGACTTGACGACGGGCGACGTGCCGCCC
AAGCGTTATGCTGCCGTGGTGCCTTTGTATGGGCACATTGACACGCAAAAGTCGATGCACAAGGTGCTAGGTACC
AAGCTCGAGGTGACGCTGGTCAAGGCTGATGGGGCTTCTTGGCCGGTGCTACGCAGTGACGAAGCAGTGACGGGT
GAAATTCTGCAGGTTGGGCGGGCTGGTTGCGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail