Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3684
Gene name
LocationContig_287:4086..5399
Strand+
Gene length (bp)1313
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08498 Sterol_MT_C Sterol methyltransferase C-terminal 4.1E-30 314 378
PF08241 Methyltransf_11 Methyltransferase domain 7.4E-21 134 230
PF13649 Methyltransf_25 Methyltransferase domain 1.0E-19 133 228
PF13847 Methyltransf_31 Methyltransferase domain 5.5E-19 129 234
PF13489 Methyltransf_23 Methyltransferase domain 1.4E-12 127 283
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.7E-12 120 235
PF02353 CMAS Mycolic acid cyclopropane synthetase 1.5E-11 78 287
PF08242 Methyltransf_12 Methyltransferase domain 1.2E-09 134 230
PF05175 MTS Methyltransferase small domain 4.6E-05 121 201
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 2.2E-04 122 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 378 0.0E+00
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 16 378 2.0E-153
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 16 378 2.0E-153
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 380 1.0E-149
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 379 1.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 378 0.0E+00
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 16 378 2.0E-153
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 16 378 2.0E-153
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 380 1.0E-149
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 379 1.0E-147
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 5 378 9.0E-144
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 4 378 1.0E-143
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 1 380 5.0E-142
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 16 378 8.0E-139
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 9 378 9.0E-131
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 9 380 1.0E-128
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 9 378 3.0E-127
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 11 380 5.0E-125
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 68 378 5.0E-99
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 46 378 8.0E-98
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 71 379 2.0E-90
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 27 380 2.0E-69
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 28 378 5.0E-69
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 28 378 2.0E-68
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 29 378 4.0E-63
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 75 380 2.0E-62
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 79 378 1.0E-59
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 68 378 2.0E-58
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 51 378 5.0E-57
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 79 378 4.0E-53
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 64 363 6.0E-32
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 80 237 1.0E-22
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 90 235 6.0E-21
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 84 299 1.0E-20
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 82 317 5.0E-16
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 81 228 1.0E-14
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 96 230 7.0E-13
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 78 230 2.0E-12
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 81 230 3.0E-12
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 101 230 8.0E-12
sp|P9WIN3|PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2952 PE=1 SV=1 69 230 6.0E-11
sp|P9WIN2|PHMT_MYCTO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3026 PE=3 SV=1 69 230 6.0E-11
sp|A5U6W0|PHMT_MYCTA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2979 PE=3 SV=1 69 230 6.0E-11
sp|A1KMU6|PHMT_MYCBP Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2973 PE=3 SV=1 69 230 6.0E-11
sp|Q7TXK3|PHMT_MYCBO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2976 PE=3 SV=1 69 230 6.0E-11
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 121 235 3.0E-10
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 121 235 3.0E-10
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 121 235 3.0E-10
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 118 235 2.0E-09
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 130 228 3.0E-09
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 134 234 4.0E-09
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 125 229 4.0E-09
sp|Q9CD86|PHMT_MYCLE Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 70 228 6.0E-09
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 125 228 7.0E-09
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 125 228 7.0E-09
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 125 228 7.0E-09
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 125 228 7.0E-09
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 125 228 7.0E-09
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 125 228 7.0E-09
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 125 235 8.0E-09
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 125 235 8.0E-09
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 119 232 9.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 125 228 1.0E-08
sp|A0PQ29|PHMT2_MYCUA Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 130 231 1.0E-08
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 130 239 2.0E-08
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 130 239 2.0E-08
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 125 229 2.0E-08
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 120 234 2.0E-08
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 130 229 2.0E-08
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 130 239 3.0E-08
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 130 239 3.0E-08
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 130 239 3.0E-08
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 130 239 3.0E-08
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 130 239 3.0E-08
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 125 290 3.0E-08
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 125 229 3.0E-08
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 125 228 3.0E-08
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 125 229 5.0E-08
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 125 229 5.0E-08
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 110 229 5.0E-08
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 110 229 5.0E-08
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 125 229 1.0E-07
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 130 247 1.0E-07
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 125 228 1.0E-07
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 130 239 2.0E-07
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 123 228 2.0E-07
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 125 229 2.0E-07
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 113 228 2.0E-07
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 69 214 3.0E-07
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 118 243 3.0E-07
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 127 242 3.0E-07
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 127 242 3.0E-07
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 69 214 3.0E-07
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 130 239 4.0E-07
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 123 228 5.0E-07
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 123 228 5.0E-07
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 123 228 5.0E-07
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 69 214 5.0E-07
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 117 230 6.0E-07
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 100 228 6.0E-07
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 125 228 8.0E-07
sp|A9ILA7|UBIE_BART1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 133 239 8.0E-07
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 123 253 9.0E-07
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 123 228 9.0E-07
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 123 228 1.0E-06
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 127 260 1.0E-06
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 118 280 1.0E-06
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 125 228 1.0E-06
sp|Q57060|Y095_HAEIN Uncharacterized protein HI_0095 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0095 PE=4 SV=1 133 238 2.0E-06
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 130 247 2.0E-06
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 123 228 2.0E-06
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|Q0WPT7|Y2104_ARATH Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana GN=At2g41040 PE=2 SV=1 86 230 2.0E-06
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 125 228 2.0E-06
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 123 228 2.0E-06
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 125 234 3.0E-06
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 113 234 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0008202 steroid metabolic process No
GO:0008150 biological_process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3684
MDPATVNLEPEDHSRDAAFTKAMHGKSAQARGGIAAMFSKGAEAKKAACDEYFKHWDNKLAADETPQDRASRTAE
YASLTRHYYNLATDLYEYGWGQCFHFCRYSYSEPFSQAIARHEHYLAHCMNIQHGMNVLDVGCGVGGPAREIAKF
TGANITGFNNNDYQIERATHYAAKEGLSKQVKFVKGDFMQMPFKDNTFDAIYAIEATVHAPTLKGIYSEILRVLK
PGGVFGVYEWLMTEEYDNDNLHHREIRLGIEHGNGISNMCKISDALEAMNDAGFEMLHNEDLADRPDPLPWYWPI
AGQIRNIQAYSDFFTILPMTHWGRFIAHNLTGVLEFLKLAPAGTKKTADTLGIAADCLVAGGKEHLFTPMYLMVG
RKPAE*
Coding >OphauG2|3684
ATGGATCCAGCAACAGTAAACCTCGAACCAGAGGACCACAGCCGCGATGCTGCCTTCACCAAGGCAATGCATGGC
AAGTCGGCACAGGCACGGGGTGGAATTGCCGCCATGTTCTCCAAAGGCGCCGAAGCCAAGAAGGCTGCCTGCGAT
GAATACTTTAAGCACTGGGACAACAAGCTGGCCGCCGACGAGACGCCCCAGGACCGAGCTTCACGAACTGCCGAA
TATGCCTCCCTGACGAGACACTACTACAATCTTGCCACAGATTTGTACGAATATGGTTGGGGACAGTGCTTTCAC
TTTTGCCGCTACTCCTACTCCGAACCCTTTTCCCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGTATG
AATATCCAGCATGGCATGAATGTCCTTGATGTTGGATGCGGCGTTGGAGGGCCCGCTCGCGAAATTGCAAAGTTT
ACTGGTGCAAACATCACCGGCTTCAACAATAACGACTACCAGATTGAGCGTGCCACTCATTACGCCGCAAAGGAA
GGCCTGTCTAAACAAGTCAAGTTTGTCAAGGGCGATTTCATGCAAATGCCCTTCAAGGACAACACGTTTGACGCC
ATCTACGCCATTGAGGCTACCGTTCACGCACCCACTCTCAAAGGTATCTACAGCGAGATTTTGCGTGTTCTCAAG
CCCGGAGGCGTCTTTGGCGTTTACGAGTGGCTCATGACGGAAGAGTACGACAACGATAATCTACACCATCGTGAG
ATTCGCCTTGGAATTGAGCACGGCAACGGCATTTCCAACATGTGCAAGATATCCGACGCTCTCGAAGCCATGAAT
GACGCTGGCTTTGAGATGCTACACAACGAGGATCTCGCCGACCGGCCTGACCCCCTGCCGTGGTACTGGCCAATT
GCTGGCCAAATCCGCAATATCCAGGCGTACAGCGACTTTTTTACTATTTTGCCCATGACCCACTGGGGCCGCTTC
ATAGCACATAATCTTACTGGTGTTCTTGAGTTTCTCAAATTGGCGCCAGCCGGCACCAAGAAGACGGCAGACACT
CTGGGAATCGCGGCAGACTGTCTAGTTGCCGGCGGCAAGGAACACCTCTTTACCCCCATGTACCTCATGGTGGGC
CGCAAGCCAGCAGAATAA
Transcript >OphauG2|3684
ATGGATCCAGCAACAGTAAACCTCGAACCAGAGGACCACAGCCGCGATGCTGCCTTCACCAAGGCAATGCATGGC
AAGTCGGCACAGGCACGGGGTGGAATTGCCGCCATGTTCTCCAAAGGCGCCGAAGCCAAGAAGGCTGCCTGCGAT
GAATACTTTAAGCACTGGGACAACAAGCTGGCCGCCGACGAGACGCCCCAGGACCGAGCTTCACGAACTGCCGAA
TATGCCTCCCTGACGAGACACTACTACAATCTTGCCACAGATTTGTACGAATATGGTTGGGGACAGTGCTTTCAC
TTTTGCCGCTACTCCTACTCCGAACCCTTTTCCCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGTATG
AATATCCAGCATGGCATGAATGTCCTTGATGTTGGATGCGGCGTTGGAGGGCCCGCTCGCGAAATTGCAAAGTTT
ACTGGTGCAAACATCACCGGCTTCAACAATAACGACTACCAGATTGAGCGTGCCACTCATTACGCCGCAAAGGAA
GGCCTGTCTAAACAAGTCAAGTTTGTCAAGGGCGATTTCATGCAAATGCCCTTCAAGGACAACACGTTTGACGCC
ATCTACGCCATTGAGGCTACCGTTCACGCACCCACTCTCAAAGGTATCTACAGCGAGATTTTGCGTGTTCTCAAG
CCCGGAGGCGTCTTTGGCGTTTACGAGTGGCTCATGACGGAAGAGTACGACAACGATAATCTACACCATCGTGAG
ATTCGCCTTGGAATTGAGCACGGCAACGGCATTTCCAACATGTGCAAGATATCCGACGCTCTCGAAGCCATGAAT
GACGCTGGCTTTGAGATGCTACACAACGAGGATCTCGCCGACCGGCCTGACCCCCTGCCGTGGTACTGGCCAATT
GCTGGCCAAATCCGCAATATCCAGGCGTACAGCGACTTTTTTACTATTTTGCCCATGACCCACTGGGGCCGCTTC
ATAGCACATAATCTTACTGGTGTTCTTGAGTTTCTCAAATTGGCGCCAGCCGGCACCAAGAAGACGGCAGACACT
CTGGGAATCGCGGCAGACTGTCTAGTTGCCGGCGGCAAGGAACACCTCTTTACCCCCATGTACCTCATGGTGGGC
CGCAAGCCAGCAGAATAA
Gene >OphauG2|3684
ATGGATCCAGCAACAGTAAACCTCGAACCAGAGGACCACAGCCGCGATGCTGCCTTCACCAAGGCAATGCATGGC
AAGTCGGCACAGGCACGGGGTGGAATTGCCGCCATGTTCTCCAAAGGCGCCGAAGCCAAGAAGGCTGCCTGCGAT
GAATACTTTAAGCACTGGGACAACAAGCTGGCCGCCGACGAGACGCCCCAGGACCGAGCTGTAAGTGGCCGACGT
TGGGCTGGCACGACACTGTGCTGATGGGAGACGTAGTCACGAACTGCCGAATATGCCTCCCTGACGAGACAGTGA
GTTTCTGTACCCAACAATCATTTTGCCATTCGCCGTCGTCTGACTCGCTCTTTAGCTACTACAATCTTGCCACAG
ATTTGTACGAATATGGTTGGGGACAGTGCTTTCACTTTTGCCGCTACTCCTACTCCGAACCCTTTTCCCAAGCCA
TTGCCCGTCATGAGCACTATCTCGCCCACTGTATGAATATCCAGCATGGCATGAATGTCCTTGATGTTGGATGCG
GCGTTGGAGGGCCCGCTCGCGAAATTGCAAAGTTTACTGGTGCAAACATCACCGGCTTCAACAATAACGACTACC
AGATTGAGCGTGCCACTCATTACGCCGCAAAGGAAGGCCTGTCTAAACAAGTCAAGTTTGTCAAGGGCGATTTCA
TGGTGAGCAAGATGCCCATTATTGTTGTTATTATTATTTATTATTACTCACACACTTGCTAGCAAATGCCCTTCA
AGGACAACACGTTTGACGCCATCTACGCCATTGAGGCTACCGTTCACGCACCCACTCTCAAAGGTATCTACAGCG
AGATTTTGCGTGTTCTCAAGCCCGGAGGCGTCTTTGGCGTTTACGAGTGGCTCATGACGGAAGAGTACGACAACG
ATAATCTACACCATCGTGAGATTCGCCTTGGAATTGAGCACGGCAACGGCATTTCCAACATGTGCAAGATATCCG
ACGCTCTCGAAGCCATGAATGACGCTGGCTTTGAGATGCTACACAACGAGGATCTCGCCGACCGGCCTGACCCCC
TGCCGTGGTACTGGCCAATTGCTGGCCAAATCCGCAATATCCAGGCGTACAGCGACTTTTTTACTATTTTGCCCA
TGACCCACTGGGGCCGCTTCATAGCACATAATCTTACTGGTGTTCTTGAGTTTCTCAAATTGGCGCCAGCCGGCA
CCAAGAAGACGGCAGACACTCTGGGAATCGCGGCAGACTGTCTAGTTGCCGGCGGCAAGGAACACCTCTTTACCC
CCATGTACCTCATGGTGGGCCGCAAGCCAGCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail