Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3683
Gene name
LocationContig_287:2328..3516
Strand-
Gene length (bp)1188
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-08 239 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RUX3|SLT11_NEUCR Pre-mRNA-splicing factor slt-11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slt-11 PE=3 SV=2 1 374 2.0E-168
sp|Q4W9V0|SLT11_ASPFU Pre-mRNA-splicing factor slt11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slt11 PE=3 SV=1 2 375 2.0E-158
sp|Q5AX35|SLT11_EMENI Pre-mRNA-splicing factor slt11 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slt11 PE=3 SV=2 1 375 4.0E-153
sp|O59800|SLT11_SCHPO Pre-mRNA-splicing factor cwf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf5 PE=1 SV=1 6 371 7.0E-73
sp|Q6C3L4|SLT11_YARLI Pre-mRNA-splicing factor SLT11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLT11 PE=3 SV=1 6 361 3.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RUX3|SLT11_NEUCR Pre-mRNA-splicing factor slt-11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slt-11 PE=3 SV=2 1 374 2.0E-168
sp|Q4W9V0|SLT11_ASPFU Pre-mRNA-splicing factor slt11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slt11 PE=3 SV=1 2 375 2.0E-158
sp|Q5AX35|SLT11_EMENI Pre-mRNA-splicing factor slt11 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slt11 PE=3 SV=2 1 375 4.0E-153
sp|O59800|SLT11_SCHPO Pre-mRNA-splicing factor cwf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf5 PE=1 SV=1 6 371 7.0E-73
sp|Q6C3L4|SLT11_YARLI Pre-mRNA-splicing factor SLT11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLT11 PE=3 SV=1 6 361 3.0E-69
sp|Q5SNN4|C3H40_ORYSJ Zinc finger CCCH domain-containing protein 40 OS=Oryza sativa subsp. japonica GN=Os06g0170500 PE=2 SV=1 1 366 6.0E-65
sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 1 366 4.0E-63
sp|Q9LNV5|C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana GN=At1g07360 PE=2 SV=1 1 372 1.0E-59
sp|Q9ZW36|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1 1 312 2.0E-58
sp|Q5ZM16|RBM22_CHICK Pre-mRNA-splicing factor RBM22 OS=Gallus gallus GN=RBM22 PE=2 SV=1 10 320 9.0E-56
sp|Q8BHS3|RBM22_MOUSE Pre-mRNA-splicing factor RBM22 OS=Mus musculus GN=Rbm22 PE=1 SV=1 10 320 1.0E-55
sp|Q4R4J1|RBM22_MACFA Pre-mRNA-splicing factor RBM22 OS=Macaca fascicularis GN=RBM22 PE=2 SV=1 10 320 1.0E-55
sp|Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens GN=RBM22 PE=1 SV=1 10 320 1.0E-55
sp|Q3B7L8|RBM22_BOVIN Pre-mRNA-splicing factor RBM22 OS=Bos taurus GN=RBM22 PE=2 SV=1 10 320 2.0E-55
sp|Q4V7D7|RBM22_RAT Pre-mRNA-splicing factor RBM22 OS=Rattus norvegicus GN=Rbm22 PE=2 SV=1 10 320 2.0E-55
sp|Q6P616|RBM22_XENTR Pre-mRNA-splicing factor RBM22 OS=Xenopus tropicalis GN=rbm22 PE=2 SV=1 10 319 3.0E-55
sp|Q5RAY5|RBM22_PONAB Pre-mRNA-splicing factor RBM22 OS=Pongo abelii GN=RBM22 PE=2 SV=1 10 320 8.0E-55
sp|Q7ZXB5|RBM22_XENLA Pre-mRNA-splicing factor RBM22 OS=Xenopus laevis GN=rbm22 PE=2 SV=1 10 319 3.0E-54
sp|Q6NZZ9|RBM22_DANRE Pre-mRNA-splicing factor RBM22 OS=Danio rerio GN=rbm22 PE=2 SV=1 10 312 2.0E-52
sp|P0CR50|SLT11_CRYNJ Pre-mRNA-splicing factor SLT11 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SLT11 PE=3 SV=1 6 311 2.0E-49
sp|P0CR51|SLT11_CRYNB Pre-mRNA-splicing factor SLT11 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SLT11 PE=3 SV=1 6 311 2.0E-49
sp|Q6BMD1|SLT11_DEBHA Pre-mRNA-splicing factor SLT11 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SLT11 PE=3 SV=2 16 354 1.0E-47
sp|Q4PGU6|SLT11_USTMA Pre-mRNA-splicing factor SLT11 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SLT11 PE=3 SV=1 15 320 1.0E-41
sp|Q9FL40|C3H53_ARATH Zinc finger CCCH domain-containing protein 53 OS=Arabidopsis thaliana GN=At5g07060 PE=2 SV=1 7 266 1.0E-38
sp|Q8I4V2|RBM22_PLAF7 Pre-mRNA-splicing factor PFL2310w OS=Plasmodium falciparum (isolate 3D7) GN=PFL2310w PE=3 SV=1 5 319 8.0E-36
sp|Q5A5N5|SLT11_CANAL Pre-mRNA-splicing factor SLT11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLT11 PE=3 SV=1 16 311 4.0E-26
sp|P38241|SLT11_YEAST Pre-mRNA-splicing factor SLT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM2 PE=1 SV=1 20 297 3.0E-21
sp|Q750K9|SLT11_ASHGO Pre-mRNA-splicing factor SLT11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SLT11 PE=3 SV=1 20 124 8.0E-16
sp|Q6FKZ2|SLT11_CANGA Pre-mRNA-splicing factor SLT11 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SLT11 PE=3 SV=1 9 255 2.0E-13
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 195 312 5.0E-08
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 233 343 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3683
MPPQIKQDLNRSGWESTDFPSVCEHCLPENPYVKMLKEDYGAECKLCTRPFTVFAWNSDRAQGRKKRTIICLTCA
RLKNCCQGCMLDLSFGLPIAVRDAALKMVAPGPQSDINREFFAQNNEKLIEEGKAGVEEYEKTDDKARELLRRLA
NSKPYFRKGRTVDESELSATGGNAVVGAGLGGPGPIRTRDTRAAAAAGAGPRHARGGGRAGRQVFPSAAQLPPSP
RDWLPPNDPNIQSLFVTGIEDDLPEHKVRDFFKVHGKIKSLVCSHMSHCAFINYETREAAEKAAAACQGRAVISG
CPLRIRWGQPRAVGNMNKEERAQMLRDARIPRTLGRNQQYSIEGGEAHPGSAGASMIAAPPGAEDTPQYSSLAGE
*
Coding >OphauG2|3683
ATGCCGCCTCAGATTAAGCAAGATCTCAACCGCTCCGGCTGGGAGTCGACCGATTTCCCCTCGGTATGCGAACAC
TGCCTGCCCGAGAATCCATATGTCAAGATGCTCAAAGAAGACTATGGCGCCGAGTGCAAACTATGTACGCGGCCT
TTTACCGTTTTCGCGTGGAACTCCGACCGAGCCCAAGGCCGAAAGAAGCGGACAATAATCTGTCTGACTTGCGCC
CGACTCAAAAACTGCTGCCAAGGATGCATGCTCGATCTCTCCTTTGGCCTCCCAATTGCTGTGCGCGATGCTGCT
CTCAAAATGGTGGCCCCTGGACCACAATCCGACATCAACCGCGAATTCTTTGCCCAAAACAATGAAAAGCTTATT
GAAGAGGGCAAGGCCGGAGTTGAAGAGTATGAAAAGACGGACGACAAGGCCCGCGAACTCCTTCGTCGCTTGGCA
AACAGCAAACCATACTTTCGCAAAGGCCGCACCGTCGATGAGTCTGAGCTTTCTGCCACTGGTGGCAACGCTGTC
GTCGGTGCAGGACTCGGTGGGCCTGGGCCAATTCGGACTCGAGATACACGGGCTGCCGCGGCTGCTGGTGCTGGT
CCGCGGCACGCAAGAGGAGGCGGGAGGGCTGGCCGACAAGTGTTTCCTAGTGCTGCGCAGCTGCCTCCGTCTCCT
CGCGACTGGCTTCCTCCCAATGACCCCAATATCCAATCTCTCTTTGTCACCGGCATCGAGGACGACTTACCAGAA
CACAAGGTTCGCGACTTTTTCAAGGTGCATGGCAAGATCAAGAGCCTCGTGTGCTCTCACATGTCACACTGTGCT
TTTATCAATTACGAGACGAGAGAGGCGGCAGAAAAGGCGGCTGCAGCTTGCCAGGGTCGTGCCGTCATCTCCGGC
TGCCCACTACGAATACGATGGGGCCAACCAAGAGCCGTCGGCAATATGAACAAGGAGGAGCGAGCCCAGATGCTT
CGCGACGCGCGCATCCCCAGGACACTGGGTCGAAATCAGCAGTACTCCATTGAGGGTGGTGAAGCGCACCCTGGC
TCAGCGGGTGCGTCCATGATAGCAGCGCCGCCTGGTGCTGAAGACACTCCTCAATATTCCAGTCTTGCTGGAGAG
TAG
Transcript >OphauG2|3683
ATGCCGCCTCAGATTAAGCAAGATCTCAACCGCTCCGGCTGGGAGTCGACCGATTTCCCCTCGGTATGCGAACAC
TGCCTGCCCGAGAATCCATATGTCAAGATGCTCAAAGAAGACTATGGCGCCGAGTGCAAACTATGTACGCGGCCT
TTTACCGTTTTCGCGTGGAACTCCGACCGAGCCCAAGGCCGAAAGAAGCGGACAATAATCTGTCTGACTTGCGCC
CGACTCAAAAACTGCTGCCAAGGATGCATGCTCGATCTCTCCTTTGGCCTCCCAATTGCTGTGCGCGATGCTGCT
CTCAAAATGGTGGCCCCTGGACCACAATCCGACATCAACCGCGAATTCTTTGCCCAAAACAATGAAAAGCTTATT
GAAGAGGGCAAGGCCGGAGTTGAAGAGTATGAAAAGACGGACGACAAGGCCCGCGAACTCCTTCGTCGCTTGGCA
AACAGCAAACCATACTTTCGCAAAGGCCGCACCGTCGATGAGTCTGAGCTTTCTGCCACTGGTGGCAACGCTGTC
GTCGGTGCAGGACTCGGTGGGCCTGGGCCAATTCGGACTCGAGATACACGGGCTGCCGCGGCTGCTGGTGCTGGT
CCGCGGCACGCAAGAGGAGGCGGGAGGGCTGGCCGACAAGTGTTTCCTAGTGCTGCGCAGCTGCCTCCGTCTCCT
CGCGACTGGCTTCCTCCCAATGACCCCAATATCCAATCTCTCTTTGTCACCGGCATCGAGGACGACTTACCAGAA
CACAAGGTTCGCGACTTTTTCAAGGTGCATGGCAAGATCAAGAGCCTCGTGTGCTCTCACATGTCACACTGTGCT
TTTATCAATTACGAGACGAGAGAGGCGGCAGAAAAGGCGGCTGCAGCTTGCCAGGGTCGTGCCGTCATCTCCGGC
TGCCCACTACGAATACGATGGGGCCAACCAAGAGCCGTCGGCAATATGAACAAGGAGGAGCGAGCCCAGATGCTT
CGCGACGCGCGCATCCCCAGGACACTGGGTCGAAATCAGCAGTACTCCATTGAGGGTGGTGAAGCGCACCCTGGC
TCAGCGGGTGCGTCCATGATAGCAGCGCCGCCTGGTGCTGAAGACACTCCTCAATATTCCAGTCTTGCTGGAGAG
TAG
Gene >OphauG2|3683
ATGCCGCCTCAGATTAAGCAAGATCTCAACCGCTCCGGCTGGGAGTCGACCGATTTCCCCTCGGTATGCGAACAC
TGCCTGCCCGAGAATCCATATGTCAAGATGCTCAAAGAAGACTATGGCGCCGAGTGCAAACTAGTAGGCCTACTC
CATGACATGTTGCAACACCCACCAACCCTTGTACTAATTGACTTGTAGTGTACGCGGCCTTTTACCGTTTTCGCG
TGGAACTCCGACCGAGCCCAAGGCCGAAAGAAGCGGACAATAATCTGTCTGACTTGCGCCCGACTCAAAAACTGC
TGCCAAGGATGCATGCTCGATCTCTCCTTTGGCCTCCCAATTGCTGTGCGCGATGCTGCTCTCAAAATGGTGGCC
CCTGGACCACAATCCGACATCAACCGCGAATTCTTTGCCCAAAACAATGAAAAGCTTATTGAAGAGGGCAAGGCC
GGAGTTGAAGAGTATGAAAAGACGGACGACAAGGCCCGCGAACTCCTTCGTCGCTTGGCAAACAGCAAACCATAC
TTTCGCAAAGGCCGCACCGTCGATGAGTCTGAGCTTTCTGCCACTGGTGGCAACGCTGTCGTCGGTGCAGGACTC
GGTGGGCCTGGGCCAATTCGGACTCGAGATACACGGGCTGCCGCGGCTGCTGGTGCTGGTCCGCGGCACGCAAGA
GGAGGCGGGAGGGCTGGCCGACAAGTGTTTCCTAGTGCTGCGCAGCTGCCTCCGTCTCCTCGCGACTGGCTTCCT
CCCAATGACCCCAATATCCAATCTCTCTTTGTCACCGGCATCGAGGACGACTTACCAGAACACAAGGTTCGCGAC
TTTTTCAAGGTGCATGGCAAGATCAAGAGCCTCGTGTGCTCTCACATGTCACACTGTGCTTTTATCAATTACGAG
ACGAGAGAGGCGGCAGAAAAGGCGGCTGCAGCTTGCCAGGGTCGTGCCGTCATCTCCGGCTGCCCACTACGAATA
CGATGGGGCCAACCAAGAGCCGTCGGCAATATGAACAAGGAGGAGCGAGCCCAGATGCTTCGCGACGCGCGCATC
CCCAGGACACTGGGTCGAAATCAGCAGTACTCCATTGAGGGTGGTGAAGCGCACCCTGGCTCAGCGGGTGCGTCC
ATGATAGCAGCGCCGCCTGGTGCTGAAGACACTCCTCAATATTCCAGTCTTGCTGGAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail