Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3680
Gene name
LocationContig_286:15607..19972
Strand+
Gene length (bp)4365
Transcript length (bp)4227
Coding sequence length (bp)4227
Protein length (aa) 1409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12257 IML1 Vacuolar membrane-associated protein Iml1 7.9E-115 158 463
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 7.3E-26 1307 1388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9J6|IML1_NEUCR Vacuolar membrane-associated protein iml1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml1 PE=3 SV=1 48 1397 0.0E+00
sp|Q2H0S0|IML1_CHAGB Vacuolar membrane-associated protein IML1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML1 PE=3 SV=1 27 1397 0.0E+00
sp|Q5AW24|IML1_EMENI Vacuolar membrane-associated protein iml1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iml1 PE=3 SV=1 104 1401 0.0E+00
sp|Q1E9Q9|IML1_COCIM Vacuolar membrane-associated protein IML1 OS=Coccidioides immitis (strain RS) GN=IML1 PE=3 SV=2 30 1401 0.0E+00
sp|A4R596|IML1_MAGO7 Vacuolar membrane-associated protein IML1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML1 PE=3 SV=2 793 1399 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9J6|IML1_NEUCR Vacuolar membrane-associated protein iml1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml1 PE=3 SV=1 48 1397 0.0E+00
sp|Q2H0S0|IML1_CHAGB Vacuolar membrane-associated protein IML1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML1 PE=3 SV=1 27 1397 0.0E+00
sp|Q5AW24|IML1_EMENI Vacuolar membrane-associated protein iml1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iml1 PE=3 SV=1 104 1401 0.0E+00
sp|Q1E9Q9|IML1_COCIM Vacuolar membrane-associated protein IML1 OS=Coccidioides immitis (strain RS) GN=IML1 PE=3 SV=2 30 1401 0.0E+00
sp|A4R596|IML1_MAGO7 Vacuolar membrane-associated protein IML1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML1 PE=3 SV=2 793 1399 0.0E+00
sp|Q2UMR9|IML1_ASPOR Vacuolar membrane-associated protein iml1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=iml1 PE=3 SV=2 44 1401 0.0E+00
sp|A4R596|IML1_MAGO7 Vacuolar membrane-associated protein IML1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML1 PE=3 SV=2 37 797 0.0E+00
sp|Q4WHH4|IML1_ASPFU Vacuolar membrane-associated protein iml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml1 PE=3 SV=1 104 590 3.0E-117
sp|A1DFV9|IML1_NEOFI Vacuolar membrane-associated protein iml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml1 PE=3 SV=1 104 590 3.0E-116
sp|Q0CHV5|IML1_ASPTN Vacuolar membrane-associated protein iml1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml1 PE=3 SV=1 44 590 5.0E-116
sp|A1CEE0|IML1_ASPCL Vacuolar membrane-associated protein iml1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml1 PE=3 SV=1 84 590 1.0E-114
sp|A1DFV9|IML1_NEOFI Vacuolar membrane-associated protein iml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml1 PE=3 SV=1 754 1401 1.0E-96
sp|Q4WHH4|IML1_ASPFU Vacuolar membrane-associated protein iml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml1 PE=3 SV=1 744 1401 9.0E-96
sp|A1CEE0|IML1_ASPCL Vacuolar membrane-associated protein iml1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml1 PE=3 SV=1 957 1401 4.0E-91
sp|Q0CHV5|IML1_ASPTN Vacuolar membrane-associated protein iml1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml1 PE=3 SV=1 956 1401 2.0E-90
sp|Q4PE51|IML1_USTMA Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IML1 PE=3 SV=1 53 595 3.0E-72
sp|O74788|IML1_SCHPO Vacuolar membrane-associated protein iml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iml1 PE=1 SV=1 59 603 2.0E-69
sp|P0CO32|IML1_CRYNJ Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IML1 PE=3 SV=1 100 593 1.0E-60
sp|P0CO33|IML1_CRYNB Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IML1 PE=3 SV=1 100 593 1.0E-60
sp|Q54XA2|Y9099_DICDI DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum GN=DDB_G0279099 PE=3 SV=1 114 463 3.0E-59
sp|Q6CAP3|IML1_YARLI Vacuolar membrane-associated protein IML1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML1 PE=3 SV=1 128 472 4.0E-57
sp|P61460|DEPD5_MOUSE DEP domain-containing protein 5 OS=Mus musculus GN=Depdc5 PE=1 SV=2 158 465 6.0E-54
sp|Q4PE51|IML1_USTMA Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IML1 PE=3 SV=1 873 1402 2.0E-53
sp|O75140|DEPD5_HUMAN DEP domain-containing protein 5 OS=Homo sapiens GN=DEPDC5 PE=1 SV=2 158 465 1.0E-52
sp|A3LRB2|IML1_PICST Vacuolar membrane-associated protein IML1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IML1 PE=3 SV=2 962 1392 2.0E-52
sp|A3LRB2|IML1_PICST Vacuolar membrane-associated protein IML1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IML1 PE=3 SV=2 124 463 2.0E-51
sp|Q6FK84|IML1_CANGA Vacuolar membrane-associated protein IML1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML1 PE=3 SV=1 153 463 2.0E-50
sp|Q5AIA4|IML1_CANAL Vacuolar membrane-associated protein IML1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IML1 PE=3 SV=1 962 1393 2.0E-50
sp|Q5AIA4|IML1_CANAL Vacuolar membrane-associated protein IML1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IML1 PE=3 SV=1 139 463 4.0E-50
sp|P47170|IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML1 PE=1 SV=1 957 1393 1.0E-49
sp|P47170|IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML1 PE=1 SV=1 37 465 2.0E-48
sp|Q6BN00|IML1_DEBHA Vacuolar membrane-associated protein IML1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IML1 PE=3 SV=2 154 472 2.0E-47
sp|Q6BN00|IML1_DEBHA Vacuolar membrane-associated protein IML1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IML1 PE=3 SV=2 848 1388 3.0E-47
sp|Q6CAP3|IML1_YARLI Vacuolar membrane-associated protein IML1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML1 PE=3 SV=1 779 1393 7.0E-47
sp|Q75DV2|IML1_ASHGO Vacuolar membrane-associated protein IML1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IML1 PE=3 SV=2 984 1393 2.0E-46
sp|O74788|IML1_SCHPO Vacuolar membrane-associated protein iml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iml1 PE=1 SV=1 947 1396 2.0E-46
sp|Q6CWI2|IML1_KLULA Vacuolar membrane-associated protein IML1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML1 PE=3 SV=1 158 465 4.0E-46
sp|Q6FK84|IML1_CANGA Vacuolar membrane-associated protein IML1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML1 PE=3 SV=1 958 1392 3.0E-45
sp|Q75DV2|IML1_ASHGO Vacuolar membrane-associated protein IML1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IML1 PE=3 SV=2 154 463 4.0E-44
sp|Q6CWI2|IML1_KLULA Vacuolar membrane-associated protein IML1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML1 PE=3 SV=1 923 1393 2.0E-42
sp|P0CO33|IML1_CRYNB Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IML1 PE=3 SV=1 984 1386 2.0E-26
sp|P0CO32|IML1_CRYNJ Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IML1 PE=3 SV=1 984 1386 2.0E-26
sp|P61460|DEPD5_MOUSE DEP domain-containing protein 5 OS=Mus musculus GN=Depdc5 PE=1 SV=2 1000 1196 5.0E-18
sp|O75140|DEPD5_HUMAN DEP domain-containing protein 5 OS=Homo sapiens GN=DEPDC5 PE=1 SV=2 838 1196 3.0E-17
sp|Q54XA2|Y9099_DICDI DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum GN=DDB_G0279099 PE=3 SV=1 999 1068 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0035556 intracellular signal transduction Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0050789 regulation of biological process No
GO:0030234 enzyme regulator activity No
GO:0008047 enzyme activator activity No
GO:0007165 signal transduction No
GO:0098772 molecular function regulator activity No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3680
MSRNAPVDAGKRLRLGPMATPPARAARRRPSAGPAEPMGRRAARCCHVGIHEGYSRDHVVLNLDLVGLQAGALVS
MTLLGAAIGPSCKPSDHGDGAEQQQEPYVFVANDMAPELKTRHAGVEVLVAKHMADAFGIKKTAQVCLAPIDKLH
RVTQATHVEITFKDYYLSRADMWRLTVDELAQRTVYKGQSILFLGTIKALVTAVYVDGRSVHSAFFVGHTRPIFR
SESARHVLFIQMAREMWDFDSDGSGEIMFSRVVNGFLPAMFKRWAALKVKHLVSIVLFARVEYDTGLTAELADSD
SYYTGIQPSGSRRPYKDFYRVVVSQMASGEWTKILYQLKREFNFFRRDISLHHQYQHVPMHEPSGTAHDGPLKRV
KAESSLCIHGNILEAINLAASQFAHDYIDRDLYRTGISIAVITPGTGVFEVDYETLGRTTEALVVNGIGIDLICM
SRMPLHSVPLFKYRNPLSCSGQGRLAPGAAFSRSFHSRGSTPNLQTPVIGSYQSVEGSLSPTKVASVGRRSDSSM
LMSPSQEWCYALPHWLHVSFWTGVSDDALSYAGIALAVSNKVEQDDDDEFRIRCRMYDLQMRSVLHVNEIETAPL
QSDANYTVDATSSSPKLQHHVLYKPCRRAPDSLVDNVTGFQRFAPDRLVRPGEKSVWKQLQEFDDSRSRLPVTQH
QHHVVRQAKGKVDDVVRKEHVVEDSSALGTWDPERKSSHSQAPTAVATATTMTTTPTMMTTTMMTTESRATATRA
TATRATATRTALQGGSTRRAVPTKKDMVPVQAQGPAATGGPSKSQSIMRHISLGLRGFGIAAAKPAVAQVKAENV
SAVSTGGEAEATGTARSLSEVRPETPQAKLGMATWSRSVAESLAGPRGESSSPHSERRSIPIAARESMADSAATQ
AQSPLGQSWSVWVQRREHEGDGRDRNVLRAEDAQKLYTNKLRAGVVPELASTLSPARALAPWLSLLDPSCPEKHQ
LDDTNLYSRWQHVFPTTSDMKEQKWKALCCPASVPLTTEYFPSKGQFDREYQRHPYNLGQNMDDEAAEEPKSRQE
FVKELISMRFSQGFQLIVGPLVAAAFGQKPIKLADVFSRDQPLEDGSSVFMSVGNTIHQLSCVNGSEVEVTIYVR
KPVDSEAAATWPAYKPAMRTLLDSGYQTRRVDFLRPQPERNWNTIDSYVAGHDDDMTEGMRFWRARFVLIPLRAR
SGWVARTQNGDNAEELRIEGIKRLAQLWHKNRYVGPAERRLQTHTLADIVYKTDDPSVVIAAELETLPLVEGNAR
SKLVTRRERFQKTHVNLAALADAMQQPVDQGGVPLRNRRWHLRTHSASFIGSDMTTWLVDNFDDVDDRDEAERLG
NALMADKAHDKAHDREKGLFVHVEKRHRFRDGNYFYRFVPDFAKPLPGCRGPASCSAT*
Coding >OphauG2|3680
ATGTCTCGCAATGCGCCCGTCGATGCTGGCAAACGCCTTCGTCTCGGCCCCATGGCTACACCGCCGGCCAGGGCT
GCGCGACGCCGGCCATCCGCTGGGCCGGCTGAGCCCATGGGCCGTCGCGCCGCGCGGTGCTGCCACGTTGGCATC
CACGAGGGCTACTCTCGCGACCATGTGGTGCTCAATCTTGACCTGGTCGGCCTCCAGGCCGGCGCCCTGGTGTCC
ATGACTCTGCTGGGCGCCGCCATTGGCCCCTCATGCAAGCCTTCGGACCATGGCGATGGGGCTGAGCAGCAGCAG
GAGCCCTATGTCTTTGTGGCCAATGACATGGCGCCCGAGCTCAAGACGCGCCACGCCGGTGTCGAGGTGCTCGTG
GCCAAGCACATGGCCGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTTGCTCCGATTGACAAGCTGCAC
CGCGTCACCCAGGCCACCCATGTCGAAATCACCTTCAAGGACTACTATCTCTCGCGAGCCGACATGTGGCGGCTG
ACGGTGGACGAGCTGGCCCAGCGGACCGTGTACAAGGGCCAGTCCATTCTCTTCCTCGGCACCATCAAGGCCCTG
GTCACGGCCGTCTATGTCGACGGCCGCAGCGTCCACTCGGCCTTTTTTGTCGGCCACACGCGGCCCATCTTCCGC
AGCGAGTCGGCCCGCCACGTGCTCTTTATCCAGATGGCGCGCGAAATGTGGGATTTTGACTCGGACGGCTCGGGC
GAAATCATGTTTAGCCGCGTCGTCAATGGCTTCCTGCCTGCCATGTTCAAGCGCTGGGCCGCCCTCAAGGTCAAG
CACCTGGTCAGCATCGTGCTCTTTGCCCGCGTCGAGTACGACACGGGCCTGACGGCGGAGCTGGCCGACAGCGAC
TCGTACTACACGGGCATCCAGCCCTCGGGCAGCCGCCGGCCCTACAAGGACTTTTACCGCGTCGTTGTCAGCCAG
ATGGCCAGTGGCGAGTGGACCAAGATTCTCTACCAGCTCAAGCGCGAATTCAACTTTTTCCGCCGCGACATTAGC
CTCCATCACCAATACCAACATGTGCCCATGCACGAGCCCTCTGGGACTGCCCACGACGGGCCTCTGAAGCGCGTC
AAGGCCGAGTCGTCGCTGTGCATCCACGGCAACATCCTAGAGGCAATCAACCTGGCGGCATCGCAGTTTGCCCAC
GACTACATTGACCGAGATCTCTACCGCACCGGCATCTCCATTGCCGTCATCACACCCGGCACCGGCGTGTTTGAA
GTCGACTACGAGACGCTTGGCCGCACCACTGAGGCTCTGGTGGTGAATGGCATTGGCATCGACCTTATTTGCATG
TCGAGGATGCCGCTGCACTCTGTGCCTCTGTTCAAGTATCGCAACCCCCTCTCTTGTTCGGGCCAGGGCCGCCTG
GCCCCTGGGGCTGCCTTTTCGCGCTCCTTTCACAGCCGCGGAAGCACTCCCAACCTCCAGACGCCAGTCATTGGC
AGCTACCAGTCTGTAGAAGGGTCTCTGTCTCCCACCAAGGTGGCGAGCGTTGGGCGGCGCAGTGACTCGTCGATG
CTCATGTCTCCAAGCCAAGAGTGGTGCTATGCTCTGCCTCACTGGCTGCACGTCTCCTTTTGGACGGGCGTGTCG
GATGACGCTCTCTCGTACGCCGGTATTGCTCTCGCCGTCTCCAACAAGGTGGAGCAGGATGACGACGACGAGTTT
CGGATTCGCTGCCGCATGTATGATTTGCAAATGCGCAGCGTTCTCCATGTCAACGAGATTGAGACGGCACCGCTG
CAGAGCGACGCCAACTACACGGTGGACGCGACCAGCTCGAGTCCCAAGCTACAGCACCACGTCTTGTACAAGCCG
TGCCGTCGCGCGCCGGATAGCCTGGTGGACAATGTGACTGGCTTCCAACGCTTTGCTCCCGACAGACTTGTTCGG
CCCGGGGAGAAGTCTGTATGGAAGCAGCTGCAGGAATTTGACGACTCGAGGAGCCGTCTGCCCGTCACCCAGCAT
CAGCACCATGTTGTGAGACAGGCAAAGGGCAAGGTTGACGATGTGGTGCGCAAGGAGCACGTGGTGGAGGATTCG
AGTGCGCTGGGGACATGGGATCCCGAGCGCAAGAGCAGCCACAGCCAAGCGCCGACAGCAGTAGCAACGGCGACG
ACAATGACGACGACGCCGACAATGATGACGACGACAATGATGACGACGGAGTCAAGGGCGACTGCGACAAGGGCG
ACTGCGACAAGGGCGACTGCGACAAGGACGGCCTTGCAAGGCGGCAGCACTCGGCGGGCAGTCCCGACTAAGAAG
GACATGGTCCCGGTCCAGGCCCAGGGCCCAGCAGCCACGGGCGGGCCAAGCAAGTCCCAGTCGATTATGAGGCAT
ATTAGCTTGGGGCTGCGCGGATTCGGCATTGCCGCTGCCAAGCCAGCCGTGGCCCAGGTCAAGGCGGAAAATGTC
AGCGCCGTATCGACTGGAGGAGAGGCCGAGGCGACGGGAACGGCGCGGTCGCTGTCTGAAGTGAGGCCGGAAACG
CCGCAGGCCAAGCTAGGCATGGCGACGTGGTCTCGGAGCGTGGCAGAGTCTCTGGCCGGGCCTCGGGGAGAATCG
AGCTCGCCTCACAGCGAGAGGCGTAGCATCCCGATTGCGGCAAGGGAGAGCATGGCAGACAGCGCGGCGACGCAG
GCGCAGTCTCCTCTGGGGCAGTCATGGAGTGTTTGGGTGCAGCGGCGAGAGCACGAGGGCGACGGGCGTGACCGC
AACGTGCTGCGGGCTGAAGATGCGCAGAAGCTCTACACCAACAAGCTGCGGGCGGGCGTGGTGCCGGAGCTGGCG
TCGACGCTGTCGCCAGCGCGGGCCCTGGCGCCGTGGCTGAGCCTGCTGGACCCGTCGTGTCCCGAGAAGCACCAG
CTGGACGACACCAATCTCTACAGCCGGTGGCAGCACGTCTTTCCCACCACGTCGGACATGAAGGAGCAGAAGTGG
AAGGCGCTTTGCTGTCCGGCATCGGTGCCGCTGACGACGGAGTATTTCCCGTCCAAGGGGCAGTTTGACCGGGAG
TACCAGAGACACCCGTACAACCTGGGCCAGAACATGGACGACGAGGCGGCCGAGGAGCCCAAGTCGCGGCAGGAG
TTTGTCAAGGAGCTGATTAGCATGCGCTTCTCGCAGGGCTTCCAGCTGATTGTGGGGCCGCTGGTTGCGGCGGCC
TTTGGGCAGAAGCCCATCAAGCTGGCGGATGTGTTTTCGCGCGACCAGCCGCTCGAGGACGGGTCGAGCGTCTTC
ATGTCGGTGGGCAACACGATCCACCAGCTGTCGTGCGTCAATGGCAGCGAGGTGGAGGTGACCATCTATGTGCGC
AAGCCGGTGGACAGCGAGGCGGCGGCGACGTGGCCGGCGTACAAGCCTGCCATGCGCACCCTGCTCGACAGCGGC
TACCAGACGCGGCGCGTCGACTTTTTGCGGCCGCAGCCCGAGCGCAACTGGAACACGATTGACTCGTATGTGGCG
GGCCACGACGACGACATGACCGAGGGCATGCGCTTCTGGCGCGCGCGCTTTGTGCTGATTCCCCTGAGGGCGCGC
AGCGGATGGGTGGCGCGGACGCAAAACGGCGACAATGCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCC
CAGCTGTGGCACAAGAACCGCTACGTGGGCCCGGCCGAGCGCCGCCTGCAGACGCACACGCTGGCCGACATTGTC
TACAAGACGGACGACCCGTCGGTGGTGATTGCCGCCGAGCTGGAGACGCTGCCGCTGGTCGAGGGCAACGCCCGG
AGCAAGCTGGTGACGCGCCGCGAGCGCTTCCAAAAGACACACGTCAACCTGGCTGCCCTGGCCGACGCCATGCAG
CAGCCCGTGGACCAGGGCGGCGTGCCGCTGCGCAACCGGCGCTGGCACCTGCGCACGCACAGCGCGTCCTTTATC
GGCTCCGACATGACGACGTGGCTGGTGGACAACTTTGACGATGTTGACGACCGCGACGAGGCGGAGCGCCTGGGC
AACGCCCTCATGGCGGACAAGGCCCACGACAAGGCCCACGACCGGGAAAAGGGGCTCTTTGTCCATGTCGAGAAG
CGCCACCGCTTCCGCGACGGCAACTACTTCTACCGCTTTGTCCCCGACTTTGCCAAGCCCCTGCCCGGCTGCCGC
GGCCCCGCGTCATGCTCAGCAACATGA
Transcript >OphauG2|3680
ATGTCTCGCAATGCGCCCGTCGATGCTGGCAAACGCCTTCGTCTCGGCCCCATGGCTACACCGCCGGCCAGGGCT
GCGCGACGCCGGCCATCCGCTGGGCCGGCTGAGCCCATGGGCCGTCGCGCCGCGCGGTGCTGCCACGTTGGCATC
CACGAGGGCTACTCTCGCGACCATGTGGTGCTCAATCTTGACCTGGTCGGCCTCCAGGCCGGCGCCCTGGTGTCC
ATGACTCTGCTGGGCGCCGCCATTGGCCCCTCATGCAAGCCTTCGGACCATGGCGATGGGGCTGAGCAGCAGCAG
GAGCCCTATGTCTTTGTGGCCAATGACATGGCGCCCGAGCTCAAGACGCGCCACGCCGGTGTCGAGGTGCTCGTG
GCCAAGCACATGGCCGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTTGCTCCGATTGACAAGCTGCAC
CGCGTCACCCAGGCCACCCATGTCGAAATCACCTTCAAGGACTACTATCTCTCGCGAGCCGACATGTGGCGGCTG
ACGGTGGACGAGCTGGCCCAGCGGACCGTGTACAAGGGCCAGTCCATTCTCTTCCTCGGCACCATCAAGGCCCTG
GTCACGGCCGTCTATGTCGACGGCCGCAGCGTCCACTCGGCCTTTTTTGTCGGCCACACGCGGCCCATCTTCCGC
AGCGAGTCGGCCCGCCACGTGCTCTTTATCCAGATGGCGCGCGAAATGTGGGATTTTGACTCGGACGGCTCGGGC
GAAATCATGTTTAGCCGCGTCGTCAATGGCTTCCTGCCTGCCATGTTCAAGCGCTGGGCCGCCCTCAAGGTCAAG
CACCTGGTCAGCATCGTGCTCTTTGCCCGCGTCGAGTACGACACGGGCCTGACGGCGGAGCTGGCCGACAGCGAC
TCGTACTACACGGGCATCCAGCCCTCGGGCAGCCGCCGGCCCTACAAGGACTTTTACCGCGTCGTTGTCAGCCAG
ATGGCCAGTGGCGAGTGGACCAAGATTCTCTACCAGCTCAAGCGCGAATTCAACTTTTTCCGCCGCGACATTAGC
CTCCATCACCAATACCAACATGTGCCCATGCACGAGCCCTCTGGGACTGCCCACGACGGGCCTCTGAAGCGCGTC
AAGGCCGAGTCGTCGCTGTGCATCCACGGCAACATCCTAGAGGCAATCAACCTGGCGGCATCGCAGTTTGCCCAC
GACTACATTGACCGAGATCTCTACCGCACCGGCATCTCCATTGCCGTCATCACACCCGGCACCGGCGTGTTTGAA
GTCGACTACGAGACGCTTGGCCGCACCACTGAGGCTCTGGTGGTGAATGGCATTGGCATCGACCTTATTTGCATG
TCGAGGATGCCGCTGCACTCTGTGCCTCTGTTCAAGTATCGCAACCCCCTCTCTTGTTCGGGCCAGGGCCGCCTG
GCCCCTGGGGCTGCCTTTTCGCGCTCCTTTCACAGCCGCGGAAGCACTCCCAACCTCCAGACGCCAGTCATTGGC
AGCTACCAGTCTGTAGAAGGGTCTCTGTCTCCCACCAAGGTGGCGAGCGTTGGGCGGCGCAGTGACTCGTCGATG
CTCATGTCTCCAAGCCAAGAGTGGTGCTATGCTCTGCCTCACTGGCTGCACGTCTCCTTTTGGACGGGCGTGTCG
GATGACGCTCTCTCGTACGCCGGTATTGCTCTCGCCGTCTCCAACAAGGTGGAGCAGGATGACGACGACGAGTTT
CGGATTCGCTGCCGCATGTATGATTTGCAAATGCGCAGCGTTCTCCATGTCAACGAGATTGAGACGGCACCGCTG
CAGAGCGACGCCAACTACACGGTGGACGCGACCAGCTCGAGTCCCAAGCTACAGCACCACGTCTTGTACAAGCCG
TGCCGTCGCGCGCCGGATAGCCTGGTGGACAATGTGACTGGCTTCCAACGCTTTGCTCCCGACAGACTTGTTCGG
CCCGGGGAGAAGTCTGTATGGAAGCAGCTGCAGGAATTTGACGACTCGAGGAGCCGTCTGCCCGTCACCCAGCAT
CAGCACCATGTTGTGAGACAGGCAAAGGGCAAGGTTGACGATGTGGTGCGCAAGGAGCACGTGGTGGAGGATTCG
AGTGCGCTGGGGACATGGGATCCCGAGCGCAAGAGCAGCCACAGCCAAGCGCCGACAGCAGTAGCAACGGCGACG
ACAATGACGACGACGCCGACAATGATGACGACGACAATGATGACGACGGAGTCAAGGGCGACTGCGACAAGGGCG
ACTGCGACAAGGGCGACTGCGACAAGGACGGCCTTGCAAGGCGGCAGCACTCGGCGGGCAGTCCCGACTAAGAAG
GACATGGTCCCGGTCCAGGCCCAGGGCCCAGCAGCCACGGGCGGGCCAAGCAAGTCCCAGTCGATTATGAGGCAT
ATTAGCTTGGGGCTGCGCGGATTCGGCATTGCCGCTGCCAAGCCAGCCGTGGCCCAGGTCAAGGCGGAAAATGTC
AGCGCCGTATCGACTGGAGGAGAGGCCGAGGCGACGGGAACGGCGCGGTCGCTGTCTGAAGTGAGGCCGGAAACG
CCGCAGGCCAAGCTAGGCATGGCGACGTGGTCTCGGAGCGTGGCAGAGTCTCTGGCCGGGCCTCGGGGAGAATCG
AGCTCGCCTCACAGCGAGAGGCGTAGCATCCCGATTGCGGCAAGGGAGAGCATGGCAGACAGCGCGGCGACGCAG
GCGCAGTCTCCTCTGGGGCAGTCATGGAGTGTTTGGGTGCAGCGGCGAGAGCACGAGGGCGACGGGCGTGACCGC
AACGTGCTGCGGGCTGAAGATGCGCAGAAGCTCTACACCAACAAGCTGCGGGCGGGCGTGGTGCCGGAGCTGGCG
TCGACGCTGTCGCCAGCGCGGGCCCTGGCGCCGTGGCTGAGCCTGCTGGACCCGTCGTGTCCCGAGAAGCACCAG
CTGGACGACACCAATCTCTACAGCCGGTGGCAGCACGTCTTTCCCACCACGTCGGACATGAAGGAGCAGAAGTGG
AAGGCGCTTTGCTGTCCGGCATCGGTGCCGCTGACGACGGAGTATTTCCCGTCCAAGGGGCAGTTTGACCGGGAG
TACCAGAGACACCCGTACAACCTGGGCCAGAACATGGACGACGAGGCGGCCGAGGAGCCCAAGTCGCGGCAGGAG
TTTGTCAAGGAGCTGATTAGCATGCGCTTCTCGCAGGGCTTCCAGCTGATTGTGGGGCCGCTGGTTGCGGCGGCC
TTTGGGCAGAAGCCCATCAAGCTGGCGGATGTGTTTTCGCGCGACCAGCCGCTCGAGGACGGGTCGAGCGTCTTC
ATGTCGGTGGGCAACACGATCCACCAGCTGTCGTGCGTCAATGGCAGCGAGGTGGAGGTGACCATCTATGTGCGC
AAGCCGGTGGACAGCGAGGCGGCGGCGACGTGGCCGGCGTACAAGCCTGCCATGCGCACCCTGCTCGACAGCGGC
TACCAGACGCGGCGCGTCGACTTTTTGCGGCCGCAGCCCGAGCGCAACTGGAACACGATTGACTCGTATGTGGCG
GGCCACGACGACGACATGACCGAGGGCATGCGCTTCTGGCGCGCGCGCTTTGTGCTGATTCCCCTGAGGGCGCGC
AGCGGATGGGTGGCGCGGACGCAAAACGGCGACAATGCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCC
CAGCTGTGGCACAAGAACCGCTACGTGGGCCCGGCCGAGCGCCGCCTGCAGACGCACACGCTGGCCGACATTGTC
TACAAGACGGACGACCCGTCGGTGGTGATTGCCGCCGAGCTGGAGACGCTGCCGCTGGTCGAGGGCAACGCCCGG
AGCAAGCTGGTGACGCGCCGCGAGCGCTTCCAAAAGACACACGTCAACCTGGCTGCCCTGGCCGACGCCATGCAG
CAGCCCGTGGACCAGGGCGGCGTGCCGCTGCGCAACCGGCGCTGGCACCTGCGCACGCACAGCGCGTCCTTTATC
GGCTCCGACATGACGACGTGGCTGGTGGACAACTTTGACGATGTTGACGACCGCGACGAGGCGGAGCGCCTGGGC
AACGCCCTCATGGCGGACAAGGCCCACGACAAGGCCCACGACCGGGAAAAGGGGCTCTTTGTCCATGTCGAGAAG
CGCCACCGCTTCCGCGACGGCAACTACTTCTACCGCTTTGTCCCCGACTTTGCCAAGCCCCTGCCCGGCTGCCGC
GGCCCCGCGTCATGCTCAGCAACATGA
Gene >OphauG2|3680
ATGTCTCGCAATGCGCCCGTCGATGCTGGCAAACGCCTTCGTCTCGGCCCCATGGCTACACCGCCGGCCAGGGCT
GCGCGACGCCGGCCATCCGCTGGGCCGGCTGAGCCCATGGGCCGTCGCGCCGCGCGGTGCTGCCACGTTGGCATC
CACGAGGGCTACTCTCGCGACCATGTGGTGCTCAATCTTGACCTGGTCGGCCTCCAGGCCGGCGCCCTGGTGTCC
ATGACTCTGCTGGGCGCCGCCATTGGCCCCTCATGCAAGCCTTCGGACCATGGCGATGGGGCTGAGCAGCAGCAG
GAGCCCTATGTCTTTGTGGCCAATGACATGGCGCCCGAGCTCAAGACGCGCCACGCCGGTGTCGAGGTGCTCGTG
GCCAAGCACATGGCCGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTTGCTCCGGTACGTGGCTCCTGC
GCCAGGGCCTGGCTCTGCTCACCCGCCTCCAGATTGACAAGCTGCACCGCGTCACCCAGGCCACCCATGTCGAAA
TCACCTTCAAGGACTACTATCTCTCGCGAGCCGACATGTGGCGGCTGACGGTGGACGAGCTGGCCCAGCGGACCG
TGTACAAGGGCCAGTCCATTCTCTTCCTCGGCACCATCAAGGCCCTGGTCACGGCCGTCTATGTCGACGGCCGCA
GCGTCCACTCGGCCTTTTTTGTCGGCCACACGCGGCCCATCTTCCGCAGCGAGTCGGCCCGCCACGTGCTCTTTA
TCCAGATGGCGCGCGAAATGTGGGATTTTGACTCGGACGGCTCGGGCGAAATCATGTTTAGCCGCGTCGTCAATG
GCTTCCTGCCTGCCATGTTCAAGCGCTGGGCCGCCCTCAAGGTCAAGCACCTGGTCAGCATCGTGCTCTTTGCCC
GCGTCGAGTACGACACGGGCCTGACGGCGGAGCTGGCCGACAGCGACTCGTACTACACGGGCATCCAGCCCTCGG
GCAGCCGCCGGCCCTACAAGGACTTTTACCGCGTCGTTGTCAGCCAGATGGCCAGTGGCGAGTGGACCAAGATTC
TCTACCAGCTCAAGCGCGAATTCAACTTTTTCCGCCGCGACATTAGCCTCCATCACCAATACCAACATGTGCCCA
TGCACGAGCCCTCTGGGACTGCCCACGACGGGCCTCTGAAGCGCGTCAAGGCCGAGTCGTCGCTGTGCATCCACG
GCAACATCCTAGAGGCAATCAACCTGGCGGCATCGCAGTTTGCCCACGACTACATTGACCGAGATCTCTACCGCA
CCGGCATCTCCATTGCCGTCATCACACCCGGCACCGGCGTGTTTGAAGTCGACTACGAGACGCTTGGCCGCACCA
CTGAGGCTCTGGTGGTGAATGGCATTGGCATCGACCTTATTTGCATGTCGAGGATGCCGCTGCACTCTGTGCCTC
TGTTCAAGTATCGCAACCCCCTCTCTTGTTCGGGCCAGGGCCGCCTGGCCCCTGGGGCTGCCTTTTCGCGCTCCT
TTCACAGCCGCGGAAGCACTCCCAACCTCCAGACGCCAGTCATTGGCAGCTACCAGTCTGTAGAAGGGTCTCTGT
CTCCCACCAAGGTGGCGAGCGTTGGGCGGCGCAGTGACTCGTCGATGCTCATGTCTCCAAGCCAAGAGTGGTGCT
ATGCTCTGCCTCACTGGCTGCACGTCTCCTTTTGGACGGGCGTGTCGGATGACGCTCTCTCGTACGCCGGTATTG
CTCTCGCCGTCTCCAACAAGGTGGAGCAGGATGACGACGACGAGTTTCGGATTCGCTGCCGCATGTATGATTTGC
AAATGCGCAGCGTTCTCCATGTCAACGAGATTGAGACGGCACCGCTGCAGAGCGACGCCAACTACACGGTGGACG
CGACCAGCTCGAGTCCCAAGCTACAGCACCACGTCTTGTACAAGCCGTGCCGTCGCGCGCCGGATAGCCTGGTGG
ACAATGTGACTGGCTTCCAACGCTTTGCTCCCGACAGACTTGTTCGGCCCGGGGAGAAGTCTGTATGGAAGCAGC
TGCAGGAATTTGACGACTCGAGGAGCCGTCTGCCCGTCACCCAGCATCAGCACCATGTTGTGAGACAGGCAAAGG
GCAAGGTTGACGATGTGGTGCGCAAGGAGCACGTGGTGGAGGATTCGAGTGCGCTGGGGACATGGGATCCCGAGC
GCAAGAGCAGCCACAGCCAAGCGCCGACAGCAGTAGCAACGGCGACGACAATGACGACGACGCCGACAATGATGA
CGACGACAATGATGACGACGGAGTCAAGGGCGACTGCGACAAGGGCGACTGCGACAAGGGCGACTGCGACAAGGA
CGGCCTTGCAAGGCGGCAGCACTCGGCGGGCAGTCCCGACTAAGAAGGACATGGTCCCGGTCCAGGCCCAGGGCC
CAGCAGCCACGGGCGGGCCAAGCAAGTCCCAGTCGATTATGAGGCATATTAGCTTGGGGCTGCGCGGATTCGGCA
TTGCCGCTGCCAAGCCAGCCGTGGCCCAGGTCAAGGCGGAAAATGTCAGCGCCGTATCGACTGGAGGAGAGGCCG
AGGCGACGGGAACGGCGCGGTCGCTGTCTGAAGTGAGGCCGGAAACGCCGCAGGCCAAGCTAGGCATGGCGACGT
GGTCTCGGAGCGTGGCAGAGTCTCTGGCCGGGCCTCGGGGAGAATCGAGCTCGCCTCACAGCGAGAGGCGTAGCA
TCCCGATTGCGGCAAGGGAGAGCATGGCAGACAGCGCGGCGACGCAGGCGCAGTCTCCTCTGGGGCAGTCATGGA
GTGTTTGGGTGCAGCGGCGAGAGCACGAGGGCGACGGGCGTGACCGCAACGTGCTGCGGGCTGAAGATGCGCAGA
AGCTCTACACCAACAAGCTGCGGGCGGGCGTGGTGCCGGAGCTGGCGTCGACGCTGTCGCCAGCGCGGGCCCTGG
CGCCGTGGCTGAGCCTGCTGGACCCGTCGTGTCCCGAGAAGCACCAGCTGGACGACACCAATCTCTACAGCCGGT
GGCAGCACGTCTTTCCCACCACGTCGGACATGAAGGAGCAGAAGTGGAAGGCGCTTTGCTGTCCGGCATCGGTGC
CGCTGACGACGGAGTATTTCCCGTCCAAGGGGCAGTTTGACCGGGAGTACCAGAGACACCCGTACAACCTGGGCC
AGAACATGGACGACGAGGCGGCCGAGGAGCCCAAGTCGCGGCAGGAGTTTGTCAAGGAGCTGATTAGCATGCGCT
TCTCGCAGGGCTTCCAGCTGATTGTGGGGCCGCTGGTTGCGGCGGCCTTTGGGCAGAAGCCCATCAAGCTGGCGG
ATGTGTTTTCGCGCGACCAGCCGCTCGAGGACGGGTCGAGCGTCTTCATGTCGGTGGGCAACACGATCCACCAGC
TGTCGTGCGTCAATGGCAGCGAGGTGGAGGTGACCATCTATGTGCGCAAGCCGGTGGACAGCGAGGCGGCGGCGA
CGTGGCCGGCGTACAAGCCTGCCATGCGCACCCTGCTCGACAGCGGCTACCAGACGCGGCGCGTCGACTTTTTGC
GGCCGCAGCCCGAGCGCAACTGGAACACGATTGACTCGTATGTGGCGGGCCACGACGACGACATGACCGAGGGCA
TGCGCTTCTGGCGCGCGCGCTTTGTGCTGATTCCCCTGAGGGCGCGCAGCGGATGGGTGGCGCGGACGCAAAACG
GCGACAATGCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCCCAGCTGTGGCACAAGAACCGCTACGTGG
GCCCGGCCGAGCGCCGCCTGCAGACGCACACGCTGGCCGACATTGTCTACAAGACGGACGACCCGTCGGTGGTGA
TTGCCGCCGAGCTGGAGACGCTGCCGCTGGTCGAGGGCAACGCCCGGAGCAAGCTGGTGACGCGCCGCGAGCGCT
TCCAAAAGACACACGTCAACCTGGCTGCCCTGGCCGACGCCATGCAGCAGCCCGTGGACCAGGGCGGCGTGCCGC
TGCGCAACCGGCGCTGGCACCTGCGCACGCACAGCGCGTCCTTTATCGGCTCCGACATGACGACGTGGCTGGTGG
ACAACTTTGACGATGTTGACGACCGCGACGAGGCGGAGCGCCTGGGCAACGCCCTCATGGCGGACAAGGCCCACG
ACAAGGCCCACGACCGGGAAAAGGGGCTCTTTGTCCATGTCGAGAAGCGCCACCGCTTCCGCGACGGCAACTACT
TCTACCGCTTTGTCCCCGACTTTGCCAAGCCCCTGCCCGGCTGGTTTGCCTCTCGCCGCTCCCTGCCCCCGACCC
CCATGGCCGACGCCGCCCGCCTCGATGCTGCGTCGCCCGCCTCGTCGCCGGCCGCCAAGCCGCGGCCCCGCGTCA
TGCTCAGCAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail