Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3666
Gene name
LocationContig_284:10534..12005
Strand+
Gene length (bp)1471
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 7.3E-16 73 164
PF08241 Methyltransf_11 Methyltransferase domain 2.3E-14 74 166
PF13489 Methyltransf_23 Methyltransferase domain 3.7E-14 57 224
PF13847 Methyltransf_31 Methyltransferase domain 2.6E-11 68 177
PF08242 Methyltransf_12 Methyltransferase domain 7.9E-10 74 165
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 7.0E-06 69 171
PF02390 Methyltransf_4 Putative methyltransferase 2.1E-05 73 106
PF00891 Methyltransf_2 O-methyltransferase domain 1.5E-05 68 180

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 67 172 1.0E-07

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0008168 methyltransferase activity Yes
GO:0008152 metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006396 RNA processing No
GO:0009451 RNA modification No
GO:0043412 macromolecule modification No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0006399 tRNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008175 tRNA methyltransferase activity No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044238 primary metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0008173 RNA methyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016740 transferase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0140098 catalytic activity, acting on RNA No
GO:0008033 tRNA processing No
GO:0034470 ncRNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3666
MDQENGTMPLDESLTETVDFHGRAYQKYALANGTYYAPIDEDEIARLELMHCIFNKVFDNRLIFPPISSPQKILD
CGCGAGDWAVQVAKRYPECEILGIDISPHMIPEDPPTNLEIQIDDLNGDFTFASNEFDLVHSQMMAGGISAQRWR
SYLRDILRVLRPGGWCQMVEMYFNAQSDNGTLKRDAALSRWSSHYLDSLHPQKDLRAALQLPRWMRSTGFTEVET
RLLTLPMCAWSNDARERSIGESNSQNVPLLLHSLALYPLTQLRGMPIDEFDKIVEQAKAEASDASLKACLDSMQA
HPTLVIC*
Coding >OphauG2|3666
ATGGACCAAGAAAATGGCACAATGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCCTAC
CAAAAATATGCCTTGGCAAACGGCACATACTATGCTCCTATTGACGAGGACGAAATTGCGCGTCTCGAGTTGATG
CATTGCATCTTCAACAAAGTCTTCGATAATCGCCTCATATTTCCTCCTATTTCCTCGCCCCAGAAAATCCTCGAT
TGTGGCTGTGGCGCCGGAGACTGGGCTGTCCAAGTCGCCAAACGATATCCCGAGTGCGAGATCCTGGGAATAGAC
ATCAGTCCGCACATGATTCCCGAGGACCCTCCAACAAACCTCGAAATACAAATCGACGACTTGAACGGAGACTTC
ACCTTTGCTTCTAATGAGTTCGATCTTGTCCACAGTCAGATGATGGCTGGAGGCATCAGCGCGCAGAGATGGCGA
AGTTACTTGCGAGACATCCTACGCGTCCTCCGACCCGGCGGATGGTGCCAAATGGTTGAGATGTATTTCAATGCC
CAATCAGACAACGGGACGCTGAAACGAGACGCCGCTCTCTCTCGATGGTCCAGCCACTATCTCGACTCGTTGCAT
CCGCAAAAAGACCTCAGGGCCGCTCTTCAACTCCCTCGGTGGATGCGCAGCACCGGATTCACAGAGGTAGAGACG
AGGCTTCTAACCCTGCCCATGTGTGCCTGGTCAAACGATGCGCGGGAGCGCAGCATTGGAGAATCCAACAGCCAA
AACGTGCCACTGCTGCTACATTCACTGGCGCTTTACCCCTTGACCCAACTCCGGGGGATGCCGATTGACGAGTTT
GACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTGATGCATCGCTCAAGGCATGTCTCGACTCAATGCAAGCC
CATCCAACACTGGTCATTTGCTGA
Transcript >OphauG2|3666
ATGGACCAAGAAAATGGCACAATGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCCTAC
CAAAAATATGCCTTGGCAAACGGCACATACTATGCTCCTATTGACGAGGACGAAATTGCGCGTCTCGAGTTGATG
CATTGCATCTTCAACAAAGTCTTCGATAATCGCCTCATATTTCCTCCTATTTCCTCGCCCCAGAAAATCCTCGAT
TGTGGCTGTGGCGCCGGAGACTGGGCTGTCCAAGTCGCCAAACGATATCCCGAGTGCGAGATCCTGGGAATAGAC
ATCAGTCCGCACATGATTCCCGAGGACCCTCCAACAAACCTCGAAATACAAATCGACGACTTGAACGGAGACTTC
ACCTTTGCTTCTAATGAGTTCGATCTTGTCCACAGTCAGATGATGGCTGGAGGCATCAGCGCGCAGAGATGGCGA
AGTTACTTGCGAGACATCCTACGCGTCCTCCGACCCGGCGGATGGTGCCAAATGGTTGAGATGTATTTCAATGCC
CAATCAGACAACGGGACGCTGAAACGAGACGCCGCTCTCTCTCGATGGTCCAGCCACTATCTCGACTCGTTGCAT
CCGCAAAAAGACCTCAGGGCCGCTCTTCAACTCCCTCGGTGGATGCGCAGCACCGGATTCACAGAGGTAGAGACG
AGGCTTCTAACCCTGCCCATGTGTGCCTGGTCAAACGATGCGCGGGAGCGCAGCATTGGAGAATCCAACAGCCAA
AACGTGCCACTGCTGCTACATTCACTGGCGCTTTACCCCTTGACCCAACTCCGGGGGATGCCGATTGACGAGTTT
GACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTGATGCATCGCTCAAGGCATGTCTCGACTCAATGCAAGCC
CATCCAACACTGGTCATTTGCTGA
Gene >OphauG2|3666
ATGGACCAAGAGTCAGGCCAATCTCTGCTTGCCTCGCTGTCGCTGGAATACTGACGCTGGTGCAAGAAATGGCAC
AATGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCCTACCAAAAATATGCCTTGGCAAA
CGGCACATACTATGCTCCTATTGACGAGGTATCCAAGAGAGTTTTGTGCCTGGCCCATTTTGAGCAAGAAACGAC
GCCATGTGATTTTTGACATGGCAGACAGGACGAAATTGCGCGTCTCGAGTTGATGCATTGCATCTTCAACAAAGT
CTTCGATAATCGCCTCATATTTCCTCCTATTTCCTCGCCCCAGAAAATCCTCGATTGTGGCTGTGGCGCCGGAGA
CTGGGCTGTCCAAGTCGCCAAACGATATCCCGAGTGCGAGGTGCGTCTTTAGTGCGAGCCCATATTCCGAGTCCA
TATTCTCCTCGTCGAGTCAAGCAACACACGACAGCAAGAAAGCGCCTCCATTGCTGGCATGGGCATAGGCCATGT
CGACGGTCGGGCTGCCACGTTTGGCCAACTCTGCATTGCCATGGCATAATCAGAAATCAAGGCTGACGGGAACGA
CTAGATCCTGGGAATAGACATCAGTCCGCACATGATTCCCGAGGACCCTCCAACAAACCTCGAAATACAAATCGA
CGACTTGAACGGAGAGTTAGCAATGCACTGTCAAGACACATGTCTGGGCCTGGCTAACAGCGGAGTCTTTGCAAG
CTTCACCTTTGCTTCTAATGAGTTCGATCTTGTCCACAGTCAGATGATGGCTGGAGGCATCAGCGCGCAGAGATG
GCGAAGTTACTTGCGAGACATCCTACGCGTCCTCCGACCCGGCGGATGGTGCCAAATGGTTGAGATGTATTTCAA
TGCCCAATCAGACAACGGGACGCTGAAACGAGGCGAGCAAGCGCAACAAGACCAGACATGGCGTGGCGACGCCTG
ACTGACAAGGACAATGTCCAGACGCCGCTCTCTCTCGATGGTCCAGCCACTATCTCGACTCGTTGCATCCGCAAA
AAGACCTCAGGGCCGCTCTTCAACTCCCTCGGTGGATGCGCAGCACCGGATTCACAGAGGTAGAGACGAGGCTTC
TAACCCTGCCCATGTGTGCCTGGTCAAACGGTGAGTCTTGTCTTGCCGGTATAGCAGTGGCTGATGCCGTGACAG
ATGCGCGGGAGCGCAGCATTGGAGAATCCAACAGCCAAAACGTGCCACTGCTGCTACATTCACTGGCGCTTTACC
CCTTGACCCAACTCCGGGGGTAGGAAAAGAGGCCCCAGACGCTTCAAGCATGCCACGGCTAACACCCATCGTCGC
CAGGATGCCGATTGACGAGTTTGACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTGATGCATCGCTCAAGGC
ATGTCTCGACTCAATGCAAGCCCATCCAACACTGGTCATTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail