Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3658
Gene name
LocationContig_283:14024..15170
Strand+
Gene length (bp)1146
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05460 ORC6 Origin recognition complex subunit 6 (ORC6) 3.9E-32 9 333

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005664 nuclear origin of replication recognition complex Yes
GO:0006260 DNA replication Yes
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0000808 origin recognition complex No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3658
MGRQIELALLSLMPSWGSDLPSALVDLAESLMAQSQHRASTLKADEEIARHYACANIACDRLKVALDLPPIQARP
PVPPRIYRRLYMHLDNVLPRQSAAQRSSRRRVSMENGAGSSSAGSGPLPSRLTPTKDASLAPFRPNKEPKAAARR
HALHPWIPPVLRFLCAETDSRRFMPTMLAGVECIVTPGGRMTQDAWTKTHVSQVVAAVYFYVMMRVRALSTKEWL
DRSGYVPLRKTILGLMKQARTQVQIKQVDEAQAWRDWQAIKPTDFDEAVAHVKDQDWLLSDWYEAIAHVAQDGGH
GEAEAAEARQEAALIPERRADTMLQEKYDYISEARRREYRQWRESMLSQIGQGMTVDSPAAA*
Coding >OphauG2|3658
ATGGGCAGGCAAATCGAGCTCGCGCTGCTGTCGCTGATGCCCTCTTGGGGCTCAGACCTCCCGTCGGCTCTCGTC
GACTTGGCCGAGTCCTTGATGGCCCAGTCCCAGCACAGGGCCAGCACTCTCAAGGCCGACGAGGAGATTGCCCGC
CACTATGCCTGTGCCAACATTGCCTGCGACCGGCTCAAAGTAGCCCTCGATCTCCCGCCCATCCAAGCACGGCCT
CCAGTGCCTCCCCGCATATACAGGCGGCTCTACATGCACCTCGACAATGTTCTTCCCAGGCAATCCGCCGCCCAG
CGCTCCAGCCGCAGGCGCGTGTCCATGGAGAATGGCGCCGGCAGCTCGTCAGCCGGCTCAGGGCCTCTCCCGTCG
AGGCTGACGCCGACCAAAGATGCCAGCCTGGCGCCCTTTAGGCCCAACAAGGAGCCCAAGGCTGCAGCCAGACGC
CATGCCTTGCATCCCTGGATACCGCCAGTCCTCAGGTTTCTGTGCGCCGAGACGGACAGTCGGAGATTTATGCCC
ACCATGCTGGCCGGCGTGGAATGCATTGTCACGCCGGGGGGCCGCATGACCCAAGATGCGTGGACCAAGACACAC
GTCAGCCAAGTCGTTGCTGCCGTCTACTTCTACGTGATGATGCGCGTCCGAGCCTTGTCGACAAAGGAATGGCTT
GACCGCAGTGGCTATGTCCCCTTGCGCAAGACCATCTTGGGCCTCATGAAGCAGGCTCGCACCCAGGTGCAAATC
AAGCAGGTCGACGAAGCGCAAGCCTGGCGCGACTGGCAAGCCATCAAGCCTACAGACTTTGACGAGGCAGTGGCG
CACGTCAAGGACCAGGACTGGCTTCTCAGCGACTGGTACGAGGCTATTGCTCATGTTGCACAAGACGGCGGACAT
GGCGAGGCCGAGGCAGCTGAAGCTCGCCAAGAGGCGGCCTTGATTCCAGAGCGCCGTGCCGATACTATGCTGCAA
GAAAAATACGATTACATTAGCGAGGCGCGGAGAAGAGAGTACCGGCAGTGGAGAGAATCAATGCTGTCCCAGATT
GGACAAGGCATGACGGTGGACAGCCCAGCAGCTGCATGA
Transcript >OphauG2|3658
ATGGGCAGGCAAATCGAGCTCGCGCTGCTGTCGCTGATGCCCTCTTGGGGCTCAGACCTCCCGTCGGCTCTCGTC
GACTTGGCCGAGTCCTTGATGGCCCAGTCCCAGCACAGGGCCAGCACTCTCAAGGCCGACGAGGAGATTGCCCGC
CACTATGCCTGTGCCAACATTGCCTGCGACCGGCTCAAAGTAGCCCTCGATCTCCCGCCCATCCAAGCACGGCCT
CCAGTGCCTCCCCGCATATACAGGCGGCTCTACATGCACCTCGACAATGTTCTTCCCAGGCAATCCGCCGCCCAG
CGCTCCAGCCGCAGGCGCGTGTCCATGGAGAATGGCGCCGGCAGCTCGTCAGCCGGCTCAGGGCCTCTCCCGTCG
AGGCTGACGCCGACCAAAGATGCCAGCCTGGCGCCCTTTAGGCCCAACAAGGAGCCCAAGGCTGCAGCCAGACGC
CATGCCTTGCATCCCTGGATACCGCCAGTCCTCAGGTTTCTGTGCGCCGAGACGGACAGTCGGAGATTTATGCCC
ACCATGCTGGCCGGCGTGGAATGCATTGTCACGCCGGGGGGCCGCATGACCCAAGATGCGTGGACCAAGACACAC
GTCAGCCAAGTCGTTGCTGCCGTCTACTTCTACGTGATGATGCGCGTCCGAGCCTTGTCGACAAAGGAATGGCTT
GACCGCAGTGGCTATGTCCCCTTGCGCAAGACCATCTTGGGCCTCATGAAGCAGGCTCGCACCCAGGTGCAAATC
AAGCAGGTCGACGAAGCGCAAGCCTGGCGCGACTGGCAAGCCATCAAGCCTACAGACTTTGACGAGGCAGTGGCG
CACGTCAAGGACCAGGACTGGCTTCTCAGCGACTGGTACGAGGCTATTGCTCATGTTGCACAAGACGGCGGACAT
GGCGAGGCCGAGGCAGCTGAAGCTCGCCAAGAGGCGGCCTTGATTCCAGAGCGCCGTGCCGATACTATGCTGCAA
GAAAAATACGATTACATTAGCGAGGCGCGGAGAAGAGAGTACCGGCAGTGGAGAGAATCAATGCTGTCCCAGATT
GGACAAGGCATGACGGTGGACAGCCCAGCAGCTGCATGA
Gene >OphauG2|3658
ATGGGCAGGCAAATCGAGCTCGCGCTGCTGTCGCTGATGCCCTCTTGGGGCTCAGACCTCCCGTCGGCTCTCGTC
GACTTGGCCGAGTCCTTGATGGCCCAGTCCCAGCACAGGGCCAGCACTCTCAAGGCCGACGAGGAGATTGCCCGC
CACTATGCCTGTGCCAACATTGCCTGCGACCGGTAAGCCTCAAGGCCTCATCTGCTTGACGAGGCCAGCTATTGA
CAGCCTTGTGCAAGGCTCAAAGTAGCCCTCGATCTCCCGCCCATCCAAGCACGGCCTCCAGTGCCTCCCCGCATA
TACAGGCGGCTCTACATGCACCTCGACAATGTTCTTCCCAGGCAATCCGCCGCCCAGCGCTCCAGCCGCAGGCGC
GTGTCCATGGAGAATGGCGCCGGCAGCTCGTCAGCCGGCTCAGGGCCTCTCCCGTCGAGGCTGACGCCGACCAAA
GATGCCAGCCTGGCGCCCTTTAGGCCCAACAAGGAGCCCAAGGCTGCAGCCAGACGCCATGCCTTGCATCCCTGG
ATACCGCCAGTCCTCAGGTTTCTGTGCGCCGAGACGGACAGTCGGAGATTTATGCCCACCATGCTGGCCGGCGTG
GAATGCATTGTCACGCCGGGGGGCCGCATGACCCAAGATGCGTGGACCAAGACACACGTCAGCCAAGTCGTTGCT
GCCGTCTACTTCTACGTGATGATGCGCGTCCGAGCCTTGTCGACAAAGGAATGGCTTGACCGCAGTGGCTATGTC
CCCTTGCGCAAGACCATCTTGGGCCTCATGAAGCAGGCTCGCACCCAGGTGCAAATCAAGCAGGTCGACGAAGCG
CAAGCCTGGCGCGACTGGCAAGCCATCAAGCCTACAGACTTTGACGAGGCAGTGGCGCACGTCAAGGACCAGGAC
TGGCTTCTCAGCGACTGGTACGAGGCTATTGCTCATGTTGCACAAGACGGCGGACATGGCGAGGCCGAGGCAGCT
GAAGCTCGCCAAGAGGCGGCCTTGATTCCAGAGCGCCGTGCCGATACTATGCTGCAAGAAAAATACGATTACATT
AGCGAGGCGCGGAGAAGAGAGTACCGGCAGTGGAGAGAATCAATGCTGTCCCAGATTGGACAAGGCATGACGGTG
GACAGCCCAGCAGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail