Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3651
Gene name
LocationContig_282:7603..10859
Strand-
Gene length (bp)3256
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04192 Utp21 Utp21 specific WD40 associated putative domain 3.4E-76 834 1041
PF00400 WD40 WD domain, G-beta repeat 2.7E-02 622 651
PF00400 WD40 WD domain, G-beta repeat 1.7E-05 704 736
PF02239 Cytochrom_D1 Cytochrome D1 heme domain 1.9E-06 685 795

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14053|UTP21_SCHPO U3 small nucleolar RNA-associated protein 21 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.07 PE=3 SV=1 9 1042 0.0E+00
sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 10 1040 8.0E-166
sp|Q8NI36|WDR36_HUMAN WD repeat-containing protein 36 OS=Homo sapiens GN=WDR36 PE=1 SV=1 6 1042 2.0E-104
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 613 770 5.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 613 770 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14053|UTP21_SCHPO U3 small nucleolar RNA-associated protein 21 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.07 PE=3 SV=1 9 1042 0.0E+00
sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 10 1040 8.0E-166
sp|Q8NI36|WDR36_HUMAN WD repeat-containing protein 36 OS=Homo sapiens GN=WDR36 PE=1 SV=1 6 1042 2.0E-104
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 613 770 5.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 613 770 5.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 613 770 5.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 613 770 5.0E-11
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 613 770 8.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 613 770 1.0E-10
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 540 740 2.0E-10
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 540 740 2.0E-10
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 540 740 2.0E-10
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 540 740 2.0E-10
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 540 740 2.0E-10
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 540 740 2.0E-10
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 540 740 2.0E-10
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 633 782 6.0E-10
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 540 740 1.0E-09
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 481 777 4.0E-09
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 622 770 5.0E-09
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 180 432 2.0E-08
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 180 432 2.0E-08
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 180 432 2.0E-08
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 613 770 2.0E-08
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 180 432 3.0E-08
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 197 432 3.0E-08
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 611 746 3.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 600 739 4.0E-08
sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 622 778 6.0E-08
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 622 777 6.0E-08
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 591 778 6.0E-08
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 602 750 7.0E-08
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 622 778 8.0E-08
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 622 778 9.0E-08
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 644 778 1.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 622 777 1.0E-07
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 622 777 2.0E-07
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 622 777 2.0E-07
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 622 777 2.0E-07
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 622 777 2.0E-07
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 622 777 2.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 622 777 2.0E-07
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 622 777 2.0E-07
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 540 740 2.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 622 778 2.0E-07
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 613 770 2.0E-07
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 613 770 2.0E-07
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 622 777 2.0E-07
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 622 777 3.0E-07
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 622 777 3.0E-07
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 180 432 3.0E-07
sp|Q09731|BU107_SCHPO UBP9-binding protein bun107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bun107 PE=1 SV=1 620 737 3.0E-07
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 622 777 3.0E-07
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 622 778 3.0E-07
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 592 747 4.0E-07
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 622 777 4.0E-07
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 540 766 4.0E-07
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 622 777 4.0E-07
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 620 808 4.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 622 777 5.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 622 777 5.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 622 777 5.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 622 777 6.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 622 777 6.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 622 777 6.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 622 777 6.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 622 777 6.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 622 777 6.0E-07
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 622 777 8.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 593 768 9.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 595 782 9.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 195 422 1.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 146 432 1.0E-06
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 615 774 1.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 622 777 1.0E-06
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 622 777 1.0E-06
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 622 777 1.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 180 432 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 633 780 2.0E-06
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 622 777 2.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 622 767 2.0E-06
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 540 766 2.0E-06
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 540 766 2.0E-06
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 540 766 2.0E-06
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 540 766 2.0E-06
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 540 766 2.0E-06
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 540 766 2.0E-06
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 540 766 2.0E-06
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 622 777 2.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 622 777 2.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 622 777 2.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 622 777 2.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 197 422 2.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 612 736 3.0E-06
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 602 736 3.0E-06
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 622 765 3.0E-06
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 600 739 3.0E-06
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 180 432 4.0E-06
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 622 747 5.0E-06
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 602 750 5.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 595 748 6.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 610 784 7.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 540 777 9.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 636 770 9.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 195 422 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0032040 small-subunit processome Yes
GO:0006364 rRNA processing Yes
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0030684 preribosome No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1672
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3651 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1250
Ophiocordyceps camponoti-floridani Ophcf2|02738
Ophiocordyceps camponoti-rufipedis Ophun1|1568
Ophiocordyceps kimflemingae Ophio5|8400
Ophiocordyceps subramaniannii Hirsu2|1425

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3651
MPPSSPDSPLAKRQKLSAVPPPATSPVHSSRLFAPFRTVGLVSPTSLPFTLVPLGKTSYQITTSVGPSLQTYDLR
RGLNLVFVTRPQTPLDITASHAWKDKLLAAWGGSRPGQPQGLWLFQRGLKISQLALPSDVSEPITQILAFGTWIV
AAARTRIQVFKSTTLEHYTTIHTMASANKGHHITGGITNMPTHLNKMLVGRSDGWVEIWNISTGKLIYTILPPSP
DCGFVTCMEPAPALSLVAIAYSTGLLVIRNILTDKPILQVDAGSQDAPVNSISFRTDGMGAGQDGRKDGVMATTT
PATGDVTFWDLNRRGRVMGVLRSAHNPPARDGSNVGGGISKAAFLPGQPVIITSGCDNSLKSWIFDKTPFSPVPR
ILHTRSGHAGAVNCLHFLPTDFDGAEAGNKWFLSGGRDRSLWGWSLRRDGQSTELSQGNVRKRAKRVGILAADAL
AHAPTTRLQDLKAPEITCIAACLNRDGGIGAMPGKQPIWQKDQKSTKAPDAETSSITGWESVVTAHKNDKYARTW
FWGRKRAGRWALPSGDGTHVSTVAMTSCGSFALVGSQGGSVIMYNLQSGSVRHGFPSRLTPSQARQVAQLQLRQA
DDVSLLQSKTATGKFAPGTGKHCKAVTGIVVDSMNKHLVTCGLDGKVKFWDFLTGTLLEQLDWSPMTSPILCRYQ
ASSNLVAFACDDMSIRIVDMDTKKTIRELWGPRDTINDVCFSNDGRWIMAASRDAIIRVWDLPTSHLIDAIALQR
PCTAMSMSSTGEYLAATIENEAGVAIWTNKALFKHVPTRQISEEEVASLSLPSLSGQGNQGLLEAAFEADEQDEP
DAVVAPSIDQLSSDLMTLSLVPKSQWQTLLHLDLVRQRNKPKEPPKAPDKAPFFLPSVSASANMAEAQNTSQNAH
DETKSRITKLDKSRLEELFSSKLRLAASTNNYDDFIQHVKSLSPSSADLELRSLSLGTGGQDDTNDLFHFIRALT
AQLKARKDYELTQAWMTVFLRLHFDLVMASDGLMKALGEWKVQQERECERLNGLVGYCSGVVSFLRSPRT*
Coding >OphauG2|3651
ATGCCGCCCTCCAGCCCCGACTCGCCCCTGGCCAAACGCCAGAAGCTGTCGGCCGTCCCCCCGCCGGCAACCTCG
CCTGTCCACTCGTCGCGCCTCTTTGCTCCGTTCCGGACTGTCGGCCTTGTCTCGCCCACTAGCCTCCCCTTCACC
TTGGTCCCTCTCGGAAAGACAAGCTATCAAATCACCACGTCGGTGGGCCCATCGCTTCAGACATACGACCTGCGC
CGAGGCCTGAATCTCGTCTTCGTAACGCGCCCCCAGACTCCCCTCGACATTACAGCGTCCCATGCATGGAAGGAC
AAGCTCCTTGCCGCATGGGGCGGCTCCCGTCCTGGCCAACCCCAAGGCCTCTGGCTCTTCCAACGAGGCCTCAAA
ATTTCTCAACTCGCTCTGCCCTCAGATGTCTCGGAGCCAATCACTCAAATACTTGCTTTTGGCACTTGGATCGTT
GCTGCGGCCCGTACGAGAATCCAAGTTTTCAAATCCACAACATTGGAGCACTACACCACCATACACACCATGGCA
TCAGCCAACAAAGGCCACCACATCACCGGCGGCATCACCAACATGCCAACCCATCTAAACAAGATGCTCGTCGGT
CGCAGCGACGGCTGGGTTGAGATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCTCCC
GACTGTGGCTTCGTCACGTGTATGGAACCGGCTCCTGCTCTCTCTCTCGTGGCAATAGCTTACTCGACTGGTCTG
CTGGTGATACGCAACATTTTGACCGACAAGCCCATCTTGCAAGTCGACGCAGGAAGCCAAGACGCACCTGTCAAC
AGCATATCCTTCAGGACTGATGGCATGGGTGCTGGCCAAGATGGCAGAAAGGACGGCGTAATGGCTACTACCACG
CCTGCCACAGGAGACGTCACCTTTTGGGATTTGAATCGACGTGGCCGTGTCATGGGAGTCCTGCGCAGCGCCCAC
AATCCGCCAGCTAGAGACGGCTCCAATGTTGGGGGAGGAATAAGCAAAGCGGCCTTTTTGCCGGGCCAGCCAGTC
ATCATCACCAGCGGGTGTGACAACTCGCTCAAATCCTGGATTTTTGACAAGACGCCCTTTTCGCCAGTGCCTCGG
ATTCTGCATACACGCAGTGGCCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGGGCC
GAAGCGGGCAATAAATGGTTTCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTGCGTCGTGACGGT
CAAAGCACGGAGCTCAGCCAGGGCAATGTTCGCAAAAGGGCCAAAAGGGTTGGCATTCTGGCTGCTGATGCTCTA
GCACACGCCCCTACAACAAGGCTACAAGACCTCAAGGCCCCAGAAATAACGTGCATTGCCGCATGCCTCAACCGA
GACGGTGGTATTGGCGCCATGCCGGGAAAGCAGCCAATATGGCAAAAGGATCAAAAGAGCACCAAGGCCCCCGAC
GCCGAAACCAGTAGCATCACGGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGG
TTCTGGGGCAGGAAGCGCGCAGGACGATGGGCGCTTCCAAGTGGCGACGGCACCCATGTGTCAACTGTAGCCATG
ACCTCGTGCGGATCCTTTGCCCTTGTTGGCTCCCAAGGGGGAAGCGTCATCATGTACAACCTTCAATCTGGCTCG
GTCCGGCATGGCTTCCCGTCACGGCTGACGCCCTCGCAAGCGCGTCAAGTTGCACAGCTACAGCTAAGGCAGGCA
GATGATGTTAGCCTACTGCAGTCCAAGACAGCCACTGGCAAATTTGCTCCAGGCACTGGCAAACATTGCAAGGCT
GTGACGGGCATCGTTGTCGACTCGATGAACAAGCATCTTGTTACATGTGGGCTCGACGGCAAGGTCAAGTTTTGG
GACTTTTTGACTGGCACGTTGCTGGAGCAGCTGGATTGGTCGCCAATGACAAGCCCGATTCTTTGCCGATATCAG
GCCTCGAGCAACTTGGTGGCTTTTGCGTGCGACGACATGTCGATTCGCATCGTCGACATGGACACCAAGAAGACC
ATTCGAGAGCTCTGGGGTCCTCGTGACACCATCAACGATGTTTGCTTTTCAAACGACGGGCGTTGGATCATGGCT
GCTTCGCGAGACGCAATCATTCGAGTGTGGGATCTGCCAACAAGCCATCTAATTGACGCAATTGCATTGCAACGG
CCCTGCACCGCCATGTCCATGTCTAGCACGGGTGAATATCTGGCGGCGACTATAGAAAACGAAGCAGGGGTTGCT
ATTTGGACCAACAAGGCGCTCTTTAAACATGTGCCCACGCGACAAATATCTGAAGAGGAAGTGGCTTCCTTGTCG
CTCCCGTCACTGTCGGGGCAAGGTAATCAAGGTCTTTTGGAGGCCGCCTTTGAAGCCGATGAGCAAGATGAGCCT
GATGCTGTTGTGGCACCAAGTATCGACCAGCTCAGCTCGGATCTGATGACGCTGAGTCTGGTTCCTAAAAGCCAA
TGGCAAACATTGCTACATCTCGACCTTGTTCGACAACGAAACAAGCCCAAGGAGCCTCCCAAGGCACCCGACAAG
GCACCATTTTTCCTTCCCTCTGTTTCTGCCTCGGCAAACATGGCTGAAGCGCAGAATACAAGTCAAAATGCCCAT
GATGAGACAAAGTCACGCATCACCAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAATTGCGACTG
GCTGCGTCTACCAACAACTATGATGATTTTATCCAACATGTCAAGTCCCTATCGCCCTCTAGCGCCGATCTGGAA
TTGCGCTCGCTCTCGTTGGGCACCGGCGGACAAGACGATACAAATGATCTTTTCCATTTCATCCGAGCCTTGACG
GCGCAGCTCAAGGCTAGAAAAGATTACGAGTTGACACAAGCATGGATGACTGTATTTCTTCGTCTTCATTTTGAC
CTTGTCATGGCAAGCGACGGCCTCATGAAGGCACTGGGCGAATGGAAGGTGCAGCAGGAGCGCGAGTGCGAGCGA
TTGAATGGTCTGGTAGGCTACTGCAGCGGCGTGGTTAGCTTTCTTAGAAGTCCGCGGACATGA
Transcript >OphauG2|3651
ATGCCGCCCTCCAGCCCCGACTCGCCCCTGGCCAAACGCCAGAAGCTGTCGGCCGTCCCCCCGCCGGCAACCTCG
CCTGTCCACTCGTCGCGCCTCTTTGCTCCGTTCCGGACTGTCGGCCTTGTCTCGCCCACTAGCCTCCCCTTCACC
TTGGTCCCTCTCGGAAAGACAAGCTATCAAATCACCACGTCGGTGGGCCCATCGCTTCAGACATACGACCTGCGC
CGAGGCCTGAATCTCGTCTTCGTAACGCGCCCCCAGACTCCCCTCGACATTACAGCGTCCCATGCATGGAAGGAC
AAGCTCCTTGCCGCATGGGGCGGCTCCCGTCCTGGCCAACCCCAAGGCCTCTGGCTCTTCCAACGAGGCCTCAAA
ATTTCTCAACTCGCTCTGCCCTCAGATGTCTCGGAGCCAATCACTCAAATACTTGCTTTTGGCACTTGGATCGTT
GCTGCGGCCCGTACGAGAATCCAAGTTTTCAAATCCACAACATTGGAGCACTACACCACCATACACACCATGGCA
TCAGCCAACAAAGGCCACCACATCACCGGCGGCATCACCAACATGCCAACCCATCTAAACAAGATGCTCGTCGGT
CGCAGCGACGGCTGGGTTGAGATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCTCCC
GACTGTGGCTTCGTCACGTGTATGGAACCGGCTCCTGCTCTCTCTCTCGTGGCAATAGCTTACTCGACTGGTCTG
CTGGTGATACGCAACATTTTGACCGACAAGCCCATCTTGCAAGTCGACGCAGGAAGCCAAGACGCACCTGTCAAC
AGCATATCCTTCAGGACTGATGGCATGGGTGCTGGCCAAGATGGCAGAAAGGACGGCGTAATGGCTACTACCACG
CCTGCCACAGGAGACGTCACCTTTTGGGATTTGAATCGACGTGGCCGTGTCATGGGAGTCCTGCGCAGCGCCCAC
AATCCGCCAGCTAGAGACGGCTCCAATGTTGGGGGAGGAATAAGCAAAGCGGCCTTTTTGCCGGGCCAGCCAGTC
ATCATCACCAGCGGGTGTGACAACTCGCTCAAATCCTGGATTTTTGACAAGACGCCCTTTTCGCCAGTGCCTCGG
ATTCTGCATACACGCAGTGGCCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGGGCC
GAAGCGGGCAATAAATGGTTTCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTGCGTCGTGACGGT
CAAAGCACGGAGCTCAGCCAGGGCAATGTTCGCAAAAGGGCCAAAAGGGTTGGCATTCTGGCTGCTGATGCTCTA
GCACACGCCCCTACAACAAGGCTACAAGACCTCAAGGCCCCAGAAATAACGTGCATTGCCGCATGCCTCAACCGA
GACGGTGGTATTGGCGCCATGCCGGGAAAGCAGCCAATATGGCAAAAGGATCAAAAGAGCACCAAGGCCCCCGAC
GCCGAAACCAGTAGCATCACGGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGG
TTCTGGGGCAGGAAGCGCGCAGGACGATGGGCGCTTCCAAGTGGCGACGGCACCCATGTGTCAACTGTAGCCATG
ACCTCGTGCGGATCCTTTGCCCTTGTTGGCTCCCAAGGGGGAAGCGTCATCATGTACAACCTTCAATCTGGCTCG
GTCCGGCATGGCTTCCCGTCACGGCTGACGCCCTCGCAAGCGCGTCAAGTTGCACAGCTACAGCTAAGGCAGGCA
GATGATGTTAGCCTACTGCAGTCCAAGACAGCCACTGGCAAATTTGCTCCAGGCACTGGCAAACATTGCAAGGCT
GTGACGGGCATCGTTGTCGACTCGATGAACAAGCATCTTGTTACATGTGGGCTCGACGGCAAGGTCAAGTTTTGG
GACTTTTTGACTGGCACGTTGCTGGAGCAGCTGGATTGGTCGCCAATGACAAGCCCGATTCTTTGCCGATATCAG
GCCTCGAGCAACTTGGTGGCTTTTGCGTGCGACGACATGTCGATTCGCATCGTCGACATGGACACCAAGAAGACC
ATTCGAGAGCTCTGGGGTCCTCGTGACACCATCAACGATGTTTGCTTTTCAAACGACGGGCGTTGGATCATGGCT
GCTTCGCGAGACGCAATCATTCGAGTGTGGGATCTGCCAACAAGCCATCTAATTGACGCAATTGCATTGCAACGG
CCCTGCACCGCCATGTCCATGTCTAGCACGGGTGAATATCTGGCGGCGACTATAGAAAACGAAGCAGGGGTTGCT
ATTTGGACCAACAAGGCGCTCTTTAAACATGTGCCCACGCGACAAATATCTGAAGAGGAAGTGGCTTCCTTGTCG
CTCCCGTCACTGTCGGGGCAAGGTAATCAAGGTCTTTTGGAGGCCGCCTTTGAAGCCGATGAGCAAGATGAGCCT
GATGCTGTTGTGGCACCAAGTATCGACCAGCTCAGCTCGGATCTGATGACGCTGAGTCTGGTTCCTAAAAGCCAA
TGGCAAACATTGCTACATCTCGACCTTGTTCGACAACGAAACAAGCCCAAGGAGCCTCCCAAGGCACCCGACAAG
GCACCATTTTTCCTTCCCTCTGTTTCTGCCTCGGCAAACATGGCTGAAGCGCAGAATACAAGTCAAAATGCCCAT
GATGAGACAAAGTCACGCATCACCAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAATTGCGACTG
GCTGCGTCTACCAACAACTATGATGATTTTATCCAACATGTCAAGTCCCTATCGCCCTCTAGCGCCGATCTGGAA
TTGCGCTCGCTCTCGTTGGGCACCGGCGGACAAGACGATACAAATGATCTTTTCCATTTCATCCGAGCCTTGACG
GCGCAGCTCAAGGCTAGAAAAGATTACGAGTTGACACAAGCATGGATGACTGTATTTCTTCGTCTTCATTTTGAC
CTTGTCATGGCAAGCGACGGCCTCATGAAGGCACTGGGCGAATGGAAGGTGCAGCAGGAGCGCGAGTGCGAGCGA
TTGAATGGTCTGGTAGGCTACTGCAGCGGCGTGGTTAGCTTTCTTAGAAGTCCGCGGACATGA
Gene >OphauG2|3651
ATGCCGCCCTCCAGCCCCGACTCGCCCCTGGCCAAACGCCAGAAGCTGTCGGCCGTCCCCCCGCCGGCAACCTCG
CCTGTCCACTCGTCGCGCCTCTTTGCTCCGTTCCGGGTATGTGACGCCAGAGCCGTGCATCATGCGCCGCTGACT
GGCTGATGTCTCCCAGACTGTCGGCCTTGTCTCGCCCACTAGCCTCCCCTTCACCTTGGTCCCTCTCGGAAAGAC
AAGCTATCAAATCACCACGTCGGTGGGCCCATCGCTTCAGACATACGACCTGCGCCGAGGCCTGAATCTCGTCTT
CGTAACGCGCCCCCAGACTCCCCTCGACATTACAGCGTCCCATGCATGGAAGGACAAGCTCCTTGCCGCATGGGG
CGGCTCCCGTCCTGGCCAACCCCAAGGCCTCTGGCTCTTCCAACGAGGCCTCAAAATTTCTCAACTCGCTCTGCC
CTCAGATGTCTCGGAGCCAATCACTCAAATACTTGCTTTTGGCACTTGGATCGTTGCTGCGGCCCGTACGAGAAT
CCAAGTTTTCAAATCCACAACATTGGAGCACTACACCACCATACACACCATGGCATCAGCCAACAAAGGCCACCA
CATCACCGGCGGCATCACCAACATGCCAACCCATCTAAACAAGATGCTCGTCGGTCGCAGCGACGGCTGGGTTGA
GATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCTCCCGACTGTGGCTTCGTCACGTG
TATGGAACCGGCTCCTGCTCTCTCTCTCGTGGCAATAGCTTACTCGACTGGTCTGCTGGTGATACGCAACATTTT
GACCGACAAGCCCATCTTGCAAGTCGACGCAGGAAGCCAAGACGCACCTGTCAACAGCATATCCTTCAGGACTGA
TGGCATGGGTGCTGGCCAAGATGGCAGAAAGGACGGCGTAATGGCTACTACCACGCCTGCCACAGGAGACGTCAC
CTTTTGGGATTTGAATCGACGTGGCCGTGTCATGGGAGTCCTGCGCAGCGCCCACAATCCGCCAGCTAGAGACGG
CTCCAATGTTGGGGGAGGAATAAGCAAAGCGGCCTTTTTGCCGGGCCAGCCAGTCATCATCACCAGCGGGTGTGA
CAACTCGCTCAAATCCTGGATTTTTGACAAGACGCCCTTTTCGCCAGTGCCTCGGATTCTGCATACACGCAGTGG
CCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGGGCCGAAGCGGGCAATAAATGGTT
TCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTGCGTCGTGACGGTCAAAGCACGGAGCTCAGCCA
GGGCAATGTTCGCAAAAGGGCCAAAAGGGTTGGCATTCTGGCTGCTGATGCTCTAGCACACGCCCCTACAACAAG
GCTACAAGACCTCAAGGCCCCAGAAATAACGTGCATTGCCGCATGCCTCAACCGAGACGGTGGTATTGGCGCCAT
GCCGGGAAAGCAGCCAATATGGCAAAAGGATCAAAAGAGCACCAAGGCCCCCGACGCCGAAACCAGTAGCATCAC
GGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGGTTCTGGGGCAGGAAGCGCGC
AGGACGATGGGCGCTTCCAAGTGGCGACGGCACCCATGTGTCAACTGTAGCCATGACCTCGTGCGGATCCTTTGC
CCTTGTTGGCTCCCAAGGGGGAAGCGTCATCATGTACAACCTTCAATCTGGCTCGGTCCGGCATGGCTTCCCGTC
ACGGCTGACGCCCTCGCAAGCGCGTCAAGTTGCACAGCTACAGCTAAGGCAGGCAGATGATGTTAGCCTACTGCA
GTCCAAGACAGCCACTGGCAAATTTGCTCCAGGCACTGGCAAACATTGCAAGGCTGTGACGGGCATCGTTGTCGA
CTCGATGAACAAGCATCTTGTTACATGTGGGCTCGACGGCAAGGTCAAGTTTTGGGACTTTTTGACTGGCACGTT
GCTGGAGCAGCTGGATTGGTCGCCAATGACAAGCCCGATTCTTTGCCGATATCAGGCCTCGAGCAACTTGGTGGC
TTTTGCGTGCGACGACATGTCGATTCGCATCGTCGACATGGACACCAAGAAGACCATTCGAGAGCTCTGGGGTCC
TCGTGACACCATCAACGATGTTTGCTTTTCAAACGACGGGCGTTGGATCATGGCTGCTTCGCGAGACGCAATCAT
TCGAGTGTGGGATCTGCCAACAAGCCATCTAATTGACGCAATTGCATTGCAACGGCCCTGCACCGCCATGTCCAT
GTCTAGCACGGGTGAATATCTGGCGGCGACTATAGAAAACGAAGCAGGGGTTGCTATTTGGACCAACAAGGCGCT
CTTTAAACATGTGCCCACGCGACAAATATCTGAAGAGGAAGTGGCTTCCTTGTCGCTCCCGTCACTGTCGGGGCA
AGGTAATCAAGGTCTTTTGGAGGCCGCCTTTGAAGCCGATGAGCAAGATGAGCCTGATGCTGTTGTGGCACCAAG
TATCGACCAGCTCAGCTCGGATCTGATGACGCTGAGTCTGGTTCCTAAAAGCCAATGGCAAACATTGCTACATCT
CGACCTTGTTCGACAACGAAACAAGCCCAAGGAGCCTCCCAAGGCACCCGACAAGGCACCATTTTTCCTTCCCTC
TGTTTCTGCCTCGGCAAACATGGCTGAAGCGCAGAATACAAGTCAAAATGCCCATGATGAGACAAAGTCACGCAT
CACCAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAATTGCGACTGGCTGCGTCTACCAACAACTG
TGAGATGGCATGCTATTTTGTAGTCTGCGCATGTTCTCTGGAGGCTAACTCTGTTTGACCAGATGATGATTTTAT
CCAACATGTCAAGTCCCTATCGCCCTCTAGCGCCGATCTGGAATTGCGCTCGCTCTCGTTGGGCACCGGCGGACA
AGACGATACAAATGATCTTTTCCATTTCATCCGAGCCTTGACGGCGCAGCTCAAGGCTAGAAAAGATTACGAGTT
GACACAAGCATGGATGACTGTATTTCTTCGTCTTCATTTTGACCTTGTCATGGCAAGCGACGGCCTCATGAAGGC
ACTGGGCGAATGGAAGGTGCAGCAGGAGCGCGAGTGCGAGCGATTGAATGGTCTGGTAGGCTACTGCAGCGGCGT
GGTTAGCTTTCTTAGAAGTCCGCGGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail