Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3641
Gene name
LocationContig_281:52..3331
Strand-
Gene length (bp)3279
Transcript length (bp)2970
Coding sequence length (bp)2970
Protein length (aa) 990

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04212 MIT MIT (microtubule interacting and transport) domain 2.5E-13 208 271

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1524
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3641 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5429
Ophiocordyceps camponoti-floridani Ophcf2|02497
Ophiocordyceps camponoti-rufipedis Ophun1|1348
Ophiocordyceps kimflemingae Ophio5|2672
Ophiocordyceps subramaniannii Hirsu2|11204

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3641
MLHSHSDGSDLSSLLSAGSLASLSLDPAVSTPSEPGLDPVLALPQPWPPPTGPAPAPSQPSFAQSSAPPPRTSSL
LPPPNTVAAAVALASHSCIDAPLPSTDDIARRHRQRAVLDNSVALPPKTFLLALSSQSPTDRRRGPCLPPRIPQP
LCDPWAPPPLLGPDTMMPSEQRQRAVPPRGHSRSRSGKSSADSTMSAGGKQGSHKAMLSRALQKANTAVQLDNAH
NFEGARLAYVEACDLLHQILDATTGPDDKKKLAKICHEYGKRIDELGQIAPQYPDNNRDSASSNKALPARPGRSE
YQDALSAGTLEGSDADFASRQEGDEASLHSSVSPSPARLRSAEDASRRQSTSTQASISMPPSGALLTSAAPRESG
ALENYIGQERPSTGGSYGESTDAAATFLHDGSQSSWLDPIDESGGSRGTSLHSRNSSTGYRRRRKRSTNGNIETR
SMNGTSEAEFDTALDAAIDAAYDDGVEIINANGVEMDAAETGEEIVSRVLRKVEMARERVRQSEREAYYNEVERR
QYQQQRHAHQGPPHLGPRNVSEGFYEDNSSDEEERILEEMVRGYGIEDFAISTDPKMAAASRPASRGHFAGPSSL
EASSAADADGLSAKNDRPPTRGTLSRTLLPAAPPPTQSLPELPTPRSTSAQSVRNRRLSTLKSKQLKIETSATRQ
PHSLAPESGFVVQPKSASAADRAPEPRFGDGPRSAAPTAPVRRGGESPPLAGGAANGPASLWSPLSNRGQAHGQI
DGADGLAKTPNSPSPQKLRKNASTTSLRSIKTRNMTVANIEDGSDLSPETTLSMTPFGGLRTPALPTVQLPLVAT
PRDHGDGSATSGFQLLEDNFHMPAYPGSLHSASPDTPVPLEPCPNEVMLRPFWLMRCLYQTMVHPRGGYMSTKLF
VPRDVWKVKGVKLKSIEDKVANCDILTGALQRLSKVDTCDADAVLDEMQSLEGVLEQVQVSLSRKLGNEVGVQSS
RRFHGGAYAPRTLL*
Coding >OphauG2|3641
ATGTTGCACTCGCACTCTGACGGCTCCGACCTCTCTTCTCTCTTGTCGGCAGGCTCGCTGGCGTCGCTCTCCCTC
GATCCCGCTGTTTCGACGCCGTCTGAGCCTGGCTTGGACCCCGTCTTGGCTCTGCCCCAGCCTTGGCCGCCGCCA
ACTGGGCCGGCTCCGGCGCCGTCTCAACCTTCTTTTGCCCAATCGTCCGCTCCTCCGCCACGAACGTCATCGCTG
CTTCCCCCACCAAACACCGTTGCAGCAGCCGTGGCCTTGGCCTCGCATTCCTGCATCGACGCTCCATTGCCCTCG
ACCGACGACATTGCCCGCCGCCACCGCCAGCGCGCTGTCCTCGACAACTCGGTCGCCCTGCCTCCCAAGACCTTT
CTGCTCGCACTGTCCTCCCAGTCTCCCACTGACCGACGTCGTGGCCCTTGTCTGCCACCCCGCATTCCACAGCCT
CTGTGCGATCCTTGGGCTCCGCCCCCGCTGCTCGGCCCCGATACCATGATGCCTTCAGAGCAACGGCAGCGAGCG
GTGCCGCCCCGAGGCCATTCCAGGAGCCGCAGCGGCAAGAGCAGCGCCGACTCGACCATGTCGGCCGGCGGCAAA
CAGGGCTCTCACAAGGCAATGCTGTCTCGCGCCCTGCAAAAGGCCAATACGGCCGTGCAGCTGGACAATGCGCAC
AACTTTGAGGGCGCCCGCCTTGCCTACGTCGAGGCCTGTGACCTGCTGCACCAAATCCTCGACGCGACGACCGGT
CCCGACGATAAGAAGAAACTGGCAAAGATTTGTCACGAATATGGAAAACGAATAGACGAACTCGGCCAGATTGCG
CCCCAATACCCAGATAACAACAGAGATTCTGCGAGCAGCAACAAGGCGCTGCCGGCCCGTCCCGGTCGTTCCGAA
TATCAAGATGCCTTGAGCGCAGGCACTCTGGAGGGATCCGATGCAGACTTTGCAAGTAGACAAGAAGGCGACGAG
GCTTCTCTACACTCTTCCGTCTCACCCTCTCCAGCTCGTTTACGGTCGGCCGAGGACGCATCGAGGCGTCAGAGC
ACAAGCACGCAAGCCAGTATATCCATGCCGCCATCGGGCGCATTGCTCACGTCTGCAGCACCAAGAGAAAGCGGC
GCTCTCGAGAACTATATTGGCCAGGAACGCCCGTCAACGGGCGGGTCGTATGGCGAGTCGACGGATGCTGCCGCA
ACATTTTTGCACGATGGCAGCCAGAGCTCGTGGCTCGATCCCATTGATGAGTCGGGCGGCTCTAGAGGCACGTCT
CTGCACTCGCGAAACTCATCGACGGGATACCGGAGAAGACGCAAACGAAGCACCAATGGAAACATTGAAACACGG
TCCATGAATGGTACTTCCGAGGCCGAGTTTGACACTGCGCTCGATGCGGCAATTGACGCCGCTTATGACGATGGA
GTCGAGATTATCAATGCCAACGGCGTTGAAATGGATGCGGCAGAGACGGGCGAAGAGATTGTTTCCAGGGTGCTA
CGCAAGGTTGAAATGGCACGCGAGCGCGTACGTCAGAGCGAGCGCGAGGCTTACTACAACGAGGTTGAGAGGCGG
CAATACCAACAGCAGCGACATGCACATCAGGGGCCTCCTCATCTAGGGCCTCGCAATGTCAGCGAGGGCTTCTAC
GAGGACAACTCATCGGATGAAGAGGAACGCATCCTGGAGGAGATGGTGCGCGGCTATGGCATTGAGGACTTTGCC
ATTAGCACGGACCCCAAGATGGCGGCGGCGTCTCGGCCAGCCTCTCGCGGCCACTTTGCTGGACCGAGCTCTTTG
GAGGCTAGCTCGGCTGCAGATGCAGATGGCCTTTCAGCCAAAAATGACAGGCCACCGACGCGAGGGACGCTTAGC
AGAACACTGCTGCCAGCTGCGCCGCCACCAACACAGTCACTGCCAGAGCTGCCGACACCCAGATCTACGTCTGCC
CAAAGCGTACGCAACCGGCGACTGTCGACGCTCAAGTCGAAGCAGCTGAAAATCGAGACGTCGGCTACGCGGCAG
CCACATTCGCTGGCCCCGGAAAGCGGATTTGTCGTGCAGCCCAAATCAGCCTCTGCCGCCGATCGGGCGCCTGAG
CCGCGATTTGGCGACGGCCCCCGCTCTGCAGCGCCAACGGCACCAGTAAGGCGAGGAGGCGAATCACCACCTCTG
GCAGGTGGTGCAGCGAATGGCCCGGCATCGCTGTGGTCGCCTCTCAGCAACCGCGGCCAGGCCCATGGGCAGATT
GACGGGGCGGATGGGCTTGCAAAAACACCCAACTCACCGTCGCCGCAGAAGCTGCGCAAGAACGCCTCTACGACT
AGCCTGCGAAGCATCAAGACGCGCAACATGACAGTTGCAAACATTGAAGACGGATCTGACTTGTCGCCCGAGACG
ACATTGAGCATGACGCCCTTTGGCGGGCTGAGGACGCCGGCGCTGCCCACGGTGCAACTGCCGCTGGTGGCGACT
CCGCGTGACCACGGAGATGGGTCGGCCACGAGCGGCTTCCAACTGCTCGAGGACAACTTCCACATGCCGGCGTAT
CCAGGGTCGCTGCATTCCGCGTCGCCAGATACGCCCGTGCCACTGGAGCCTTGCCCCAATGAGGTGATGCTGCGG
CCGTTTTGGCTGATGCGGTGCCTGTACCAGACCATGGTGCATCCCCGAGGCGGCTACATGAGCACCAAGCTGTTT
GTGCCACGCGACGTGTGGAAGGTCAAGGGCGTCAAGCTCAAGAGCATCGAGGACAAGGTGGCCAACTGCGACATC
TTGACGGGGGCGTTGCAGCGTCTCTCCAAGGTGGACACGTGTGACGCGGATGCCGTGCTGGACGAGATGCAGTCG
CTCGAGGGCGTGCTGGAGCAGGTGCAAGTGTCTCTGAGCCGCAAGCTGGGCAACGAAGTCGGCGTGCAGAGTTCT
CGTCGTTTTCATGGCGGCGCCTACGCTCCAAGAACTCTGCTCTGA
Transcript >OphauG2|3641
ATGTTGCACTCGCACTCTGACGGCTCCGACCTCTCTTCTCTCTTGTCGGCAGGCTCGCTGGCGTCGCTCTCCCTC
GATCCCGCTGTTTCGACGCCGTCTGAGCCTGGCTTGGACCCCGTCTTGGCTCTGCCCCAGCCTTGGCCGCCGCCA
ACTGGGCCGGCTCCGGCGCCGTCTCAACCTTCTTTTGCCCAATCGTCCGCTCCTCCGCCACGAACGTCATCGCTG
CTTCCCCCACCAAACACCGTTGCAGCAGCCGTGGCCTTGGCCTCGCATTCCTGCATCGACGCTCCATTGCCCTCG
ACCGACGACATTGCCCGCCGCCACCGCCAGCGCGCTGTCCTCGACAACTCGGTCGCCCTGCCTCCCAAGACCTTT
CTGCTCGCACTGTCCTCCCAGTCTCCCACTGACCGACGTCGTGGCCCTTGTCTGCCACCCCGCATTCCACAGCCT
CTGTGCGATCCTTGGGCTCCGCCCCCGCTGCTCGGCCCCGATACCATGATGCCTTCAGAGCAACGGCAGCGAGCG
GTGCCGCCCCGAGGCCATTCCAGGAGCCGCAGCGGCAAGAGCAGCGCCGACTCGACCATGTCGGCCGGCGGCAAA
CAGGGCTCTCACAAGGCAATGCTGTCTCGCGCCCTGCAAAAGGCCAATACGGCCGTGCAGCTGGACAATGCGCAC
AACTTTGAGGGCGCCCGCCTTGCCTACGTCGAGGCCTGTGACCTGCTGCACCAAATCCTCGACGCGACGACCGGT
CCCGACGATAAGAAGAAACTGGCAAAGATTTGTCACGAATATGGAAAACGAATAGACGAACTCGGCCAGATTGCG
CCCCAATACCCAGATAACAACAGAGATTCTGCGAGCAGCAACAAGGCGCTGCCGGCCCGTCCCGGTCGTTCCGAA
TATCAAGATGCCTTGAGCGCAGGCACTCTGGAGGGATCCGATGCAGACTTTGCAAGTAGACAAGAAGGCGACGAG
GCTTCTCTACACTCTTCCGTCTCACCCTCTCCAGCTCGTTTACGGTCGGCCGAGGACGCATCGAGGCGTCAGAGC
ACAAGCACGCAAGCCAGTATATCCATGCCGCCATCGGGCGCATTGCTCACGTCTGCAGCACCAAGAGAAAGCGGC
GCTCTCGAGAACTATATTGGCCAGGAACGCCCGTCAACGGGCGGGTCGTATGGCGAGTCGACGGATGCTGCCGCA
ACATTTTTGCACGATGGCAGCCAGAGCTCGTGGCTCGATCCCATTGATGAGTCGGGCGGCTCTAGAGGCACGTCT
CTGCACTCGCGAAACTCATCGACGGGATACCGGAGAAGACGCAAACGAAGCACCAATGGAAACATTGAAACACGG
TCCATGAATGGTACTTCCGAGGCCGAGTTTGACACTGCGCTCGATGCGGCAATTGACGCCGCTTATGACGATGGA
GTCGAGATTATCAATGCCAACGGCGTTGAAATGGATGCGGCAGAGACGGGCGAAGAGATTGTTTCCAGGGTGCTA
CGCAAGGTTGAAATGGCACGCGAGCGCGTACGTCAGAGCGAGCGCGAGGCTTACTACAACGAGGTTGAGAGGCGG
CAATACCAACAGCAGCGACATGCACATCAGGGGCCTCCTCATCTAGGGCCTCGCAATGTCAGCGAGGGCTTCTAC
GAGGACAACTCATCGGATGAAGAGGAACGCATCCTGGAGGAGATGGTGCGCGGCTATGGCATTGAGGACTTTGCC
ATTAGCACGGACCCCAAGATGGCGGCGGCGTCTCGGCCAGCCTCTCGCGGCCACTTTGCTGGACCGAGCTCTTTG
GAGGCTAGCTCGGCTGCAGATGCAGATGGCCTTTCAGCCAAAAATGACAGGCCACCGACGCGAGGGACGCTTAGC
AGAACACTGCTGCCAGCTGCGCCGCCACCAACACAGTCACTGCCAGAGCTGCCGACACCCAGATCTACGTCTGCC
CAAAGCGTACGCAACCGGCGACTGTCGACGCTCAAGTCGAAGCAGCTGAAAATCGAGACGTCGGCTACGCGGCAG
CCACATTCGCTGGCCCCGGAAAGCGGATTTGTCGTGCAGCCCAAATCAGCCTCTGCCGCCGATCGGGCGCCTGAG
CCGCGATTTGGCGACGGCCCCCGCTCTGCAGCGCCAACGGCACCAGTAAGGCGAGGAGGCGAATCACCACCTCTG
GCAGGTGGTGCAGCGAATGGCCCGGCATCGCTGTGGTCGCCTCTCAGCAACCGCGGCCAGGCCCATGGGCAGATT
GACGGGGCGGATGGGCTTGCAAAAACACCCAACTCACCGTCGCCGCAGAAGCTGCGCAAGAACGCCTCTACGACT
AGCCTGCGAAGCATCAAGACGCGCAACATGACAGTTGCAAACATTGAAGACGGATCTGACTTGTCGCCCGAGACG
ACATTGAGCATGACGCCCTTTGGCGGGCTGAGGACGCCGGCGCTGCCCACGGTGCAACTGCCGCTGGTGGCGACT
CCGCGTGACCACGGAGATGGGTCGGCCACGAGCGGCTTCCAACTGCTCGAGGACAACTTCCACATGCCGGCGTAT
CCAGGGTCGCTGCATTCCGCGTCGCCAGATACGCCCGTGCCACTGGAGCCTTGCCCCAATGAGGTGATGCTGCGG
CCGTTTTGGCTGATGCGGTGCCTGTACCAGACCATGGTGCATCCCCGAGGCGGCTACATGAGCACCAAGCTGTTT
GTGCCACGCGACGTGTGGAAGGTCAAGGGCGTCAAGCTCAAGAGCATCGAGGACAAGGTGGCCAACTGCGACATC
TTGACGGGGGCGTTGCAGCGTCTCTCCAAGGTGGACACGTGTGACGCGGATGCCGTGCTGGACGAGATGCAGTCG
CTCGAGGGCGTGCTGGAGCAGGTGCAAGTGTCTCTGAGCCGCAAGCTGGGCAACGAAGTCGGCGTGCAGAGTTCT
CGTCGTTTTCATGGCGGCGCCTACGCTCCAAGAACTCTGCTCTGA
Gene >OphauG2|3641
ATGTTGCACTCGCACTCTGACGGCTCCGACCTCTCTTCTCTCTTGTCGGCAGGCTCGCTGGCGTCGCTCTCCCTC
GATCCCGCTGTTTCGACGCCGTCTGAGCCTGGCTTGGACCCCGTCTTGGCTCTGCCCCAGCCTTGGCCGCCGCCA
ACTGGGCCGGCTCCGGCGCCGTCTCAACCTTCTTTTGCCCAATCGTCCGCTCCTCCGCCACGAACGTCATCGCTG
CTTCCCCCACCAAACACCGTTGCAGCAGCCGTGGCCTTGGCCTCGCATTCCTGCATCGACGCTCCATTGCCCTCG
ACCGACGACATTGCCCGCCGCCACCGCCAGCGCGCTGTCCTCGACAACTCGGTCGCCCTGCCTCCCAAGACCTTT
CTGCTCGCACTGTCCTCCCAGTCTCCCACTGACCGACGTCGTGGCCCTTGTCTGCCACCCCGCATTCCACAGCCT
CTGTGCGATCCTTGGGCTCCGCCCCCGCTGCTCGGCCCCGATACCATGATGCCTTCAGAGCAACGGCAGCGAGCG
GTGCCGCCCCGAGGCCATTCCAGGAGCCGCAGCGGCAAGAGCAGCGCCGACTCGACCATGTCGGCCGGCGGCAAA
CAGGGCTCTCACAAGGCAATGCTGTCTCGCGCCCTGCAAAAGGCCAATACGGCCGTGCAGCTGGACAATGCGCAC
AACTTTGAGGGCGCCCGCCTTGCCTACGTCGAGGCCTGTGACCTGCTGCACCAAATCCTCGACGCGACGACCGGT
CCCGACGATAAGAAGAAACTGGCAAAGATTGTGAGTCGGGCCCCCTTTTTTCTTCCCTCTTCCCCATGCAGAGCG
TGAATACGAATATTGGCTTGCTGACATGGTGGGCCTCTACTGTCCAGTGTCACGAATATGGAAAACGAATAGACG
AACTCGGCCAGATTGCGCCCCAATACCCAGATAACAACAGAGATTCTGCGAGCAGCAACAAGGCGCTGCCGGCCC
GTCCCGGTCGTTCCGAATATCAAGATGCCTTGAGCGCAGGCACTCTGGAGGGATCCGATGCAGACTTTGCAAGTA
GACAAGAAGGCGACGAGGCACGTATTCCTCTATCCAAGTCGCTTTTCATGTCTTTTTTTCTTTCTACACGGGCAA
GGACCACTTGTGTATTGCTAGATGTATCAAGTGTTGAATGGTGCCGCGCATGGAATTCTAACATGTCAACCTAGG
CTTCTCTACACTCTTCCGTCTCACCCTCTCCAGCTCGTTTACGGTCGGCCGAGGACGCATCGAGGCGTCAGAGCA
CAAGCACGCAAGCCAGTATATCCATGCCGCCATCGGGCGCATTGCTCACGTCTGCAGCACCAAGAGAAAGCGGCG
CTCTCGAGAACTATATTGGCCAGGAACGCCCGTCAACGGGCGGGTCGTATGGCGAGTCGACGGATGCTGCCGCAA
CATTTTTGCACGATGGCAGCCAGAGCTCGTGGCTCGATCCCATTGATGAGTCGGGCGGCTCTAGAGGCACGTCTC
TGCACTCGCGAAACTCATCGACGGGATACCGGAGAAGACGCAAACGAAGCACCAATGGAAACATTGAAACACGGT
CCATGAATGGTACTTCCGAGGCCGAGTTTGACACTGCGCTCGATGCGGCAATTGACGCCGCTTATGACGATGGAG
TCGAGATTATCAATGCCAACGGCGTTGAAATGGATGCGGCAGAGACGGGCGAAGAGATTGTTTCCAGGGTGCTAC
GCAAGGTTGAAATGGCACGCGAGCGCGTACGTCAGAGCGAGCGCGAGGCTTACTACAACGAGGTTGAGAGGCGGC
AATACCAACAGCAGCGACATGCACATCAGGGGCCTCCTCATCTAGGGCCTCGCAATGTCAGCGAGGGCTTCTACG
AGGACAACTCATCGGATGAAGAGGAACGCATCCTGGAGGAGATGGTGCGCGGCTATGGCATTGAGGACTTTGCCA
TTAGCACGGACCCCAAGATGGCGGCGGCGTCTCGGCCAGCCTCTCGCGGCCACTTTGCTGGACCGAGCTCTTTGG
AGGCTAGCTCGGCTGCAGATGCAGATGGCCTTTCAGCCAAAAATGACAGGCCACCGACGCGAGGGACGCTTAGCA
GAACACTGCTGCCAGCTGCGCCGCCACCAACACAGTCACTGCCAGAGCTGCCGACACCCAGATCTACGTCTGCCC
AAAGCGTACGCAACCGGCGACTGTCGACGCTCAAGTCGAAGCAGCTGAAAATCGAGACGTCGGCTACGCGGCAGC
CACATTCGCTGGCCCCGGAAAGCGGATTTGTCGTGCAGCCCAAATCAGCCTCTGCCGCCGATCGGGCGCCTGAGC
CGCGATTTGGCGACGGCCCCCGCTCTGCAGCGCCAACGGCACCAGTAAGGCGAGGAGGCGAATCACCACCTCTGG
CAGGTGGTGCAGCGAATGGCCCGGCATCGCTGTGGTCGCCTCTCAGCAACCGCGGCCAGGCCCATGGGCAGATTG
ACGGGGCGGATGGGCTTGCAAAAACACCCAACTCACCGTCGCCGCAGAAGCTGCGCAAGAACGCCTCTACGACTA
GCCTGCGAAGCATCAAGACGCGCAACATGACAGTTGCAAACATTGAAGACGGATCTGACTTGTCGCCCGAGACGA
CATTGAGCATGACGCCCTTTGGCGGGCTGAGGACGCCGGCGCTGCCCACGGTGCAACTGCCGCTGGTGGCGACTC
CGCGTGACCACGGAGATGGGTCGGCCACGAGCGGCTTCCAACTGCTCGAGGACAACTTCCACATGCCGGCGTATC
CAGGGTCGCTGCATTCCGCGTCGCCAGATACGCCCGTGCCACTGGAGCCTTGCCCCAATGAGGTGATGCTGCGGC
CGTTTTGGCTGATGCGGTGCCTGTACCAGACCATGGTGCATCCCCGAGGCGGCTACATGAGCACCAAGCTGTTTG
TGCCACGCGACGTGTGGAAGGTCAAGGGCGTCAAGCTCAAGAGCATCGAGGACAAGGTGGCCAACTGCGACATCT
TGACGGGGGCGTTGCAGCGTCTCTCCAAGGTGGACACGTGTGACGCGGATGCCGTGCTGGACGAGATGCAGTCGC
TCGAGGGCGTGCTGGAGCAGGTGCAAGTGTCTCTGAGCCGCAAGCTGGGCAACGAAGTCGGCGTGCAGAGTTCGT
CGGTTCTCTTCAAGGATGCCACCAATGTGGTTGACAGCGACGGGGCGATGGCGGCGCCACGCGTCACGAGCGTGT
CGAGCAAGTCGTCGTTTTCATGGCGGCGCCTACGCTCCAAGAACTCTGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail