Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|364
Gene name
LocationContig_1080:2960..3803
Strand+
Gene length (bp)843
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|364 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7226
Ophiocordyceps camponoti-floridani Ophcf2|05479
Ophiocordyceps camponoti-rufipedis Ophun1|334
Ophiocordyceps kimflemingae Ophio5|7411
Ophiocordyceps subramaniannii Hirsu2|1024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|364
MDGSCPRPAKAPERPWSLAALKHDTGAVPSCPPLPHDLAPTSPSAVDSLSEPGQAGGVFLKIAGSQPPVELLVGQ
LENQSLDVTMGLDEDGEDSFSQGLVLGKPEPDNKLQPMDVDMQEAGEVETALSMVRHRMEATGFGKRYYSQAFGS
ATAGGPPIARAEQSSAQPRPASTTESKAPVEAQDSNPSMGGKLEADEGYCEGDDDMSWLGGDELMPGLSSSARSN
GLLKFQTSAERAMQCSMVVRKTARMRRRRHHKREIRKRPPETETATTAASTVMGK*
Coding >OphauG2|364
ATGGATGGCTCATGCCCGCGGCCCGCCAAGGCACCAGAGAGGCCGTGGTCGCTGGCGGCCCTCAAGCACGACACT
GGCGCAGTACCATCTTGTCCGCCATTACCCCATGATTTAGCACCTACGTCGCCAAGCGCCGTTGACTCGCTCTCG
GAGCCAGGCCAAGCTGGCGGTGTGTTTTTAAAAATTGCAGGTAGCCAGCCGCCCGTGGAGCTGCTCGTCGGCCAG
CTGGAGAATCAGAGTCTCGACGTCACCATGGGCCTGGATGAAGATGGCGAGGACAGCTTCTCGCAAGGACTGGTC
CTGGGTAAGCCGGAGCCAGATAACAAGCTGCAGCCCATGGACGTGGATATGCAAGAGGCTGGAGAGGTAGAGACA
GCATTGTCAATGGTTCGGCACAGGATGGAGGCGACAGGCTTTGGCAAAAGGTATTACAGCCAAGCTTTTGGGTCA
GCAACAGCTGGCGGCCCCCCAATCGCAAGGGCAGAGCAGTCGTCGGCTCAGCCCAGACCAGCGTCGACTACAGAA
AGTAAAGCACCGGTAGAAGCACAGGACTCAAATCCGTCCATGGGTGGCAAACTCGAGGCTGACGAGGGGTATTGC
GAGGGTGATGACGACATGTCATGGCTCGGCGGCGATGAACTCATGCCCGGCCTATCGTCGTCGGCACGTAGCAAT
GGATTGCTCAAGTTCCAAACCTCAGCAGAGAGGGCGATGCAATGTTCCATGGTGGTGCGAAAGACGGCACGGATG
CGGCGCAGAAGACACCACAAACGAGAGATAAGAAAGCGTCCCCCGGAGACGGAAACGGCAACAACAGCGGCATCA
ACGGTAATGGGCAAATGA
Transcript >OphauG2|364
ATGGATGGCTCATGCCCGCGGCCCGCCAAGGCACCAGAGAGGCCGTGGTCGCTGGCGGCCCTCAAGCACGACACT
GGCGCAGTACCATCTTGTCCGCCATTACCCCATGATTTAGCACCTACGTCGCCAAGCGCCGTTGACTCGCTCTCG
GAGCCAGGCCAAGCTGGCGGTGTGTTTTTAAAAATTGCAGGTAGCCAGCCGCCCGTGGAGCTGCTCGTCGGCCAG
CTGGAGAATCAGAGTCTCGACGTCACCATGGGCCTGGATGAAGATGGCGAGGACAGCTTCTCGCAAGGACTGGTC
CTGGGTAAGCCGGAGCCAGATAACAAGCTGCAGCCCATGGACGTGGATATGCAAGAGGCTGGAGAGGTAGAGACA
GCATTGTCAATGGTTCGGCACAGGATGGAGGCGACAGGCTTTGGCAAAAGGTATTACAGCCAAGCTTTTGGGTCA
GCAACAGCTGGCGGCCCCCCAATCGCAAGGGCAGAGCAGTCGTCGGCTCAGCCCAGACCAGCGTCGACTACAGAA
AGTAAAGCACCGGTAGAAGCACAGGACTCAAATCCGTCCATGGGTGGCAAACTCGAGGCTGACGAGGGGTATTGC
GAGGGTGATGACGACATGTCATGGCTCGGCGGCGATGAACTCATGCCCGGCCTATCGTCGTCGGCACGTAGCAAT
GGATTGCTCAAGTTCCAAACCTCAGCAGAGAGGGCGATGCAATGTTCCATGGTGGTGCGAAAGACGGCACGGATG
CGGCGCAGAAGACACCACAAACGAGAGATAAGAAAGCGTCCCCCGGAGACGGAAACGGCAACAACAGCGGCATCA
ACGGTAATGGGCAAATGA
Gene >OphauG2|364
ATGGATGGCTCATGCCCGCGGCCCGCCAAGGCACCAGAGAGGCCGTGGTCGCTGGCGGCCCTCAAGCACGACACT
GGCGCAGTACCATCTTGTCCGCCATTACCCCATGATTTAGCACCTACGTCGCCAAGCGCCGTTGACTCGCTCTCG
GAGCCAGGCCAAGCTGGCGGTGTGTTTTTAAAAATTGCAGGTAGCCAGCCGCCCGTGGAGCTGCTCGTCGGCCAG
CTGGAGAATCAGAGTCTCGACGTCACCATGGGCCTGGATGAAGATGGCGAGGACAGCTTCTCGCAAGGACTGGTC
CTGGGTAAGCCGGAGCCAGATAACAAGCTGCAGCCCATGGACGTGGATATGCAAGAGGCTGGAGAGGTAGAGACA
GCATTGTCAATGGTTCGGCACAGGATGGAGGCGACAGGCTTTGGCAAAAGGTATTACAGCCAAGCTTTTGGGTCA
GCAACAGCTGGCGGCCCCCCAATCGCAAGGGCAGAGCAGTCGTCGGCTCAGCCCAGACCAGCGTCGACTACAGAA
AGTAAAGCACCGGTAGAAGCACAGGACTCAAATCCGTCCATGGGTGGCAAACTCGAGGCTGACGAGGGGTATTGC
GAGGGTGATGACGACATGTCATGGCTCGGCGGCGATGAACTCATGCCCGGCCTATCGTCGTCGGCACGTAGCAAT
GGATTGCTCAAGTTCCAAACCTCAGCAGAGAGGGCGATGCAATGTTCCATGGTGGTGCGAAAGACGGCACGGATG
CGGCGCAGAAGACACCACAAACGAGAGATAAGAAAGCGTCCCCCGGAGACGGAAACGGCAACAACAGCGGCATCA
ACGGTAATGGGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail