Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3638
Gene name
LocationContig_280:11659..12873
Strand+
Gene length (bp)1214
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 3.1E-50 135 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1 10 379 1.0E-32
sp|Q9US14|YK64_SCHPO Uncharacterized inositol polyphosphate kinase C607.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.04 PE=3 SV=1 20 310 2.0E-19
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 103 382 7.0E-18
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 133 382 1.0E-17
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 133 382 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1 10 379 1.0E-32
sp|Q9US14|YK64_SCHPO Uncharacterized inositol polyphosphate kinase C607.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.04 PE=3 SV=1 20 310 2.0E-19
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 103 382 7.0E-18
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 133 382 1.0E-17
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 133 382 3.0E-16
sp|Q8BWD2|IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus GN=Ip6k3 PE=2 SV=1 135 281 2.0E-14
sp|Q96PC2|IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens GN=IP6K3 PE=1 SV=2 135 384 1.0E-13
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 126 280 2.0E-10
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 126 280 5.0E-10
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 126 280 7.0E-10
sp|Q80V72|IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus GN=Ip6k2 PE=2 SV=2 126 280 1.0E-09
sp|Q8NFU5|IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens GN=IPMK PE=1 SV=1 115 280 6.0E-09
sp|Q99NI4|IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus GN=Ipmk PE=2 SV=1 115 328 7.0E-09
sp|Q7TT16|IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus GN=Ipmk PE=1 SV=1 115 280 7.0E-09
sp|O74561|YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.08 PE=1 SV=1 132 281 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0016301 kinase activity Yes
GO:0006066 alcohol metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0046165 alcohol biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0009987 cellular process No
GO:0019637 organophosphate metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0046173 polyol biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0019751 polyol metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3638 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5613
Ophiocordyceps camponoti-floridani Ophcf2|06306
Ophiocordyceps camponoti-rufipedis Ophun1|2267
Ophiocordyceps kimflemingae Ophio5|7326
Ophiocordyceps subramaniannii Hirsu2|1345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3638
MGFRELPSRDQLRDCNHAVAGHAGTMCDAQGELFIKPCTQSEIDFYQSALRRHPEFAEIMPRFMGSLLLSDPCAK
GINDDVAGVISQVGNIETAKEHIAATVAEQVANAPMLREPSDDASWTPNRARKINTDKAVVLENATFGFKQANIL
DIKLGVRLWADDAPPEKKRRFDKISSETTHSSLGFRIAGMRVYRGSKDVSELDQEGYKIYDKDYGRLLVKEENVV
DELAKFIFNKEAGIGQELGKAVCSAFARDLARVRNVMSRHESRMYSTSLLFVFEGDGAALRSAIEENNALADLAN
QRAPAIDRTTKRIDSGIGLEDDVDSDADDGQDDEFDALESSLPQIYTLKLIDFAHAQWTPGLGPDENTLTGVRNL
ERIFEQLAE*
Coding >OphauG2|3638
ATGGGATTCAGGGAGTTGCCGAGTCGCGACCAGCTTCGCGACTGCAACCATGCTGTTGCTGGACACGCGGGCACA
ATGTGTGATGCCCAAGGCGAACTCTTCATCAAGCCCTGCACCCAGTCCGAAATTGACTTTTACCAGTCTGCTTTG
CGGCGGCATCCCGAGTTTGCCGAGATAATGCCGCGTTTCATGGGATCCTTGCTTCTCAGCGACCCGTGTGCCAAG
GGCATCAATGACGACGTTGCCGGCGTTATATCCCAGGTCGGCAACATTGAAACGGCCAAGGAACACATCGCAGCA
ACGGTTGCCGAGCAAGTGGCCAACGCGCCCATGCTGAGGGAGCCCAGTGACGATGCGTCATGGACTCCCAATCGA
GCCCGCAAAATCAACACGGACAAGGCGGTGGTGCTTGAAAATGCCACCTTTGGCTTCAAGCAAGCCAACATTCTC
GACATCAAGCTTGGTGTGCGGCTATGGGCCGACGATGCACCACCAGAGAAGAAGCGACGCTTTGACAAGATTTCC
TCTGAAACAACACACTCTTCGTTGGGTTTTCGCATCGCCGGCATGAGGGTCTATCGCGGCTCAAAAGACGTTTCC
GAGTTGGATCAAGAAGGCTACAAGATCTACGACAAGGACTACGGGCGGCTACTGGTCAAGGAAGAAAACGTGGTG
GATGAGCTCGCCAAGTTTATCTTCAACAAAGAAGCCGGCATCGGCCAAGAGCTTGGCAAGGCAGTGTGTTCGGCC
TTTGCGCGGGACCTTGCCAGGGTTCGCAATGTCATGTCACGACACGAAAGCCGAATGTACTCGACGTCGCTGCTC
TTCGTTTTCGAGGGCGACGGCGCTGCATTGCGGTCAGCAATTGAGGAAAACAATGCCTTGGCAGACTTGGCCAAT
CAACGAGCGCCGGCTATTGACCGGACGACGAAGCGAATTGATAGCGGCATTGGCTTGGAAGACGATGTCGATAGC
GACGCCGACGATGGCCAAGATGATGAATTCGACGCCTTGGAGAGCTCCTTGCCGCAGATTTACACGCTCAAGCTC
ATCGACTTTGCGCATGCACAATGGACGCCTGGCCTTGGCCCAGATGAAAACACACTCACGGGAGTGCGAAACTTG
GAGCGCATCTTTGAGCAGTTGGCAGAATGA
Transcript >OphauG2|3638
ATGGGATTCAGGGAGTTGCCGAGTCGCGACCAGCTTCGCGACTGCAACCATGCTGTTGCTGGACACGCGGGCACA
ATGTGTGATGCCCAAGGCGAACTCTTCATCAAGCCCTGCACCCAGTCCGAAATTGACTTTTACCAGTCTGCTTTG
CGGCGGCATCCCGAGTTTGCCGAGATAATGCCGCGTTTCATGGGATCCTTGCTTCTCAGCGACCCGTGTGCCAAG
GGCATCAATGACGACGTTGCCGGCGTTATATCCCAGGTCGGCAACATTGAAACGGCCAAGGAACACATCGCAGCA
ACGGTTGCCGAGCAAGTGGCCAACGCGCCCATGCTGAGGGAGCCCAGTGACGATGCGTCATGGACTCCCAATCGA
GCCCGCAAAATCAACACGGACAAGGCGGTGGTGCTTGAAAATGCCACCTTTGGCTTCAAGCAAGCCAACATTCTC
GACATCAAGCTTGGTGTGCGGCTATGGGCCGACGATGCACCACCAGAGAAGAAGCGACGCTTTGACAAGATTTCC
TCTGAAACAACACACTCTTCGTTGGGTTTTCGCATCGCCGGCATGAGGGTCTATCGCGGCTCAAAAGACGTTTCC
GAGTTGGATCAAGAAGGCTACAAGATCTACGACAAGGACTACGGGCGGCTACTGGTCAAGGAAGAAAACGTGGTG
GATGAGCTCGCCAAGTTTATCTTCAACAAAGAAGCCGGCATCGGCCAAGAGCTTGGCAAGGCAGTGTGTTCGGCC
TTTGCGCGGGACCTTGCCAGGGTTCGCAATGTCATGTCACGACACGAAAGCCGAATGTACTCGACGTCGCTGCTC
TTCGTTTTCGAGGGCGACGGCGCTGCATTGCGGTCAGCAATTGAGGAAAACAATGCCTTGGCAGACTTGGCCAAT
CAACGAGCGCCGGCTATTGACCGGACGACGAAGCGAATTGATAGCGGCATTGGCTTGGAAGACGATGTCGATAGC
GACGCCGACGATGGCCAAGATGATGAATTCGACGCCTTGGAGAGCTCCTTGCCGCAGATTTACACGCTCAAGCTC
ATCGACTTTGCGCATGCACAATGGACGCCTGGCCTTGGCCCAGATGAAAACACACTCACGGGAGTGCGAAACTTG
GAGCGCATCTTTGAGCAGTTGGCAGAATGA
Gene >OphauG2|3638
ATGGGATTCAGGGAGTTGCCGAGTCGCGACCAGCTTCGCGACTGCAACCATGCTGTTGCTGGACAGTGAGTCGAT
GCAACGCACGCTGCTGAATGCCCTGGCTCCTACTGACGGCCCCTTCCAGCGCGGGCACAATGTGTGATGCCCAAG
GCGAACTCTTCATCAAGCCCTGCACCCAGTCCGAAATTGACTTTTACCAGTCTGCTTTGCGGCGGCATCCCGAGT
TTGCCGAGATAATGCCGCGTTTCATGGGATCCTTGCTTCTCAGCGACCCGTGTGCCAAGGGCATCAATGACGACG
TTGCCGGCGTTATATCCCAGGTCGGCAACATTGAAACGGCCAAGGAACACATCGCAGCAACGGTTGCCGAGCAAG
TGGCCAACGCGCCCATGCTGAGGGAGCCCAGTGACGATGCGTCATGGACTCCCAATCGAGCCCGCAAAATCAACA
CGGACAAGGCGGTGGTGCTTGAAAATGCCACCTTTGGCTTCAAGCAAGCCAACATTCTCGACATCAAGCTTGGTG
TGCGGCTATGGGCCGACGATGCACCACCAGAGAAGAAGCGACGCTTTGACAAGATTTCCTCTGAAACAACACACT
CTTCGTTGGGTTTTCGCATCGCCGGCATGAGGGTCTATCGCGGCTCAAAAGACGTTTCCGAGTTGGATCAAGAAG
GCTACAAGATCTACGACAAGGACTACGGGCGGCTACTGGTCAAGGAAGAAAACGTGGTGGATGAGCTCGCCAAGT
TTATCTTCAACAAAGAAGCCGGCATCGGCCAAGAGCTTGGCAAGGCAGTGTGTTCGGCCTTTGCGCGGGACCTTG
CCAGGGTTCGCAATGTCATGTCACGACACGAAAGCCGAATGTACTCGACGTCGCTGCTCTTCGTTTTCGAGGGCG
ACGGCGCTGCATTGCGGTCAGCAATTGAGGAAAACAATGCCTTGGCAGACTTGGCCAATCAACGAGCGCCGGCTA
TTGACCGGACGACGAAGCGAATTGATAGCGGCATTGGCTTGGAAGACGATGTCGATAGCGACGCCGACGATGGCC
AAGATGATGAATTCGACGCCTTGGAGAGCTCCTTGCCGCAGATTTACACGCTCAAGCTCATCGACTTTGCGCATG
CACAATGGACGCCTGGCCTTGGCCCAGATGAAAACACACTCACGGGAGTGCGAAACTTGGAGCGCATCTTTGAGC
AGTTGGCAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail