© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|3610 |
| Gene name | |
| Location | Contig_279:16629..18841 |
| Strand | + |
| Gene length (bp) | 2212 |
| Transcript length (bp) | 1314 |
| Coding sequence length (bp) | 1314 |
| Protein length (aa) | 438 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00682 | HMGL-like | HMGL-like | 1.3E-78 | 45 | 304 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94225|HOSM_PENRW | Homocitrate synthase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lys1 PE=1 SV=1 | 25 | 417 | 0.0E+00 |
| sp|Q12122|HOSM_YEAST | Homocitrate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS21 PE=1 SV=1 | 27 | 416 | 0.0E+00 |
| sp|P48570|HOSC_YEAST | Homocitrate synthase, cytosolic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS20 PE=1 SV=1 | 28 | 413 | 0.0E+00 |
| sp|Q12726|HOSM_YARLI | Homocitrate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS1 PE=3 SV=1 | 1 | 431 | 0.0E+00 |
| sp|Q9Y823|HOSM_SCHPO | Homocitrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys4 PE=1 SV=1 | 19 | 418 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94225|HOSM_PENRW | Homocitrate synthase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lys1 PE=1 SV=1 | 25 | 417 | 0.0E+00 |
| sp|Q12122|HOSM_YEAST | Homocitrate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS21 PE=1 SV=1 | 27 | 416 | 0.0E+00 |
| sp|P48570|HOSC_YEAST | Homocitrate synthase, cytosolic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS20 PE=1 SV=1 | 28 | 413 | 0.0E+00 |
| sp|Q12726|HOSM_YARLI | Homocitrate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS1 PE=3 SV=1 | 1 | 431 | 0.0E+00 |
| sp|Q9Y823|HOSM_SCHPO | Homocitrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys4 PE=1 SV=1 | 19 | 418 | 0.0E+00 |
| sp|O87198|HOSC_THET2 | Homocitrate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lys20 PE=1 SV=2 | 45 | 412 | 6.0E-140 |
| sp|Q971S5|HOSA_SULTO | Putative homocitrate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_13010 PE=3 SV=1 | 47 | 398 | 2.0E-64 |
| sp|C3NDV7|HOSA_SULIY | Putative homocitrate synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_1230 PE=3 SV=1 | 47 | 398 | 2.0E-61 |
| sp|C3NHU6|HOSA_SULIN | Putative homocitrate synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_1618 PE=3 SV=1 | 47 | 398 | 2.0E-61 |
| sp|C3MYM1|HOSA_SULIM | Putative homocitrate synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1245 PE=3 SV=1 | 47 | 398 | 2.0E-61 |
| sp|C4KGW9|HOSA_SULIK | Putative homocitrate synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1229 PE=3 SV=1 | 47 | 398 | 2.0E-61 |
| sp|C3N5A3|HOSA_SULIA | Putative homocitrate synthase OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_1295 PE=3 SV=1 | 47 | 398 | 2.0E-61 |
| sp|Q58595|LEU1_METJA | 2-isopropylmalate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuA PE=1 SV=1 | 39 | 396 | 7.0E-61 |
| sp|C3MPM7|HOSA_SULIL | Putative homocitrate synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_1332 PE=3 SV=1 | 47 | 398 | 8.0E-61 |
| sp|Q8TYB1|LEU1_METKA | Probable 2-isopropylmalate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-60 |
| sp|O30020|LEU1_ARCFU | Probable 2-isopropylmalate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuA PE=3 SV=1 | 45 | 396 | 4.0E-58 |
| sp|Q8RCF9|LEU12_CALS4 | 2-isopropylmalate synthase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuA2 PE=3 SV=1 | 47 | 395 | 2.0E-57 |
| sp|Q57926|AKSA_METJA | Probable homocitrate synthase AksA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aksA PE=1 SV=3 | 31 | 396 | 4.0E-57 |
| sp|Q9V1J1|HOSA_PYRAB | Putative homocitrate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB04360 PE=3 SV=1 | 47 | 377 | 2.0E-55 |
| sp|Q58787|CIMA_METJA | (R)-citramalate synthase CimA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=cimA PE=1 SV=1 | 45 | 418 | 2.0E-55 |
| sp|O27525|LEU1_METTH | Probable 2-isopropylmalate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuA PE=3 SV=1 | 46 | 416 | 1.0E-54 |
| sp|O59390|HOSA_PYRHO | Putative homocitrate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1727 PE=3 SV=1 | 47 | 393 | 1.0E-54 |
| sp|Q97ZE0|HOSA_SULSO | Putative homocitrate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0977 PE=3 SV=1 | 47 | 398 | 2.0E-54 |
| sp|O27667|AKSA_METTH | Putative homocitrate synthase AksA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aksA PE=3 SV=1 | 44 | 392 | 2.0E-54 |
| sp|O29305|CIMA_ARCFU | Putative (R)-citramalate synthase CimA OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cimA PE=3 SV=1 | 44 | 396 | 3.0E-52 |
| sp|A8AB61|LEU1_IGNH4 | Probable 2-isopropylmalate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuA PE=3 SV=1 | 35 | 391 | 8.0E-52 |
| sp|P58968|LEU1_METMA | Probable 2-isopropylmalate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuA PE=3 SV=1 | 44 | 406 | 7.0E-51 |
| sp|Q8THA5|LEU1_METAC | Probable 2-isopropylmalate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuA PE=3 SV=1 | 44 | 406 | 7.0E-51 |
| sp|Q974X3|LEU1_SULTO | Probable 2-isopropylmalate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuA PE=3 SV=1 | 41 | 396 | 3.0E-50 |
| sp|Q8TW28|AKSA_METKA | Putative homocitrate synthase AksA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aksA PE=3 SV=1 | 47 | 398 | 9.0E-50 |
| sp|O26819|CIMA_METTH | Putative (R)-citramalate synthase CimA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=cimA PE=3 SV=1 | 44 | 397 | 1.0E-49 |
| sp|Q8RDK3|LEU11_CALS4 | 2-isopropylmalate synthase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuA1 PE=3 SV=1 | 44 | 404 | 8.0E-49 |
| sp|B7GH19|LEU1_ANOFW | 2-isopropylmalate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuA PE=3 SV=1 | 42 | 395 | 1.0E-48 |
| sp|Q9K8E8|LEU1_BACHD | 2-isopropylmalate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuA PE=3 SV=1 | 42 | 404 | 9.0E-48 |
| sp|P05342|NIFV_AZOVI | Homocitrate synthase OS=Azotobacter vinelandii GN=nifV PE=3 SV=2 | 47 | 422 | 1.0E-47 |
| sp|Q44290|NIFV1_NOSS1 | Homocitrate synthase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifV1 PE=3 SV=2 | 42 | 392 | 4.0E-47 |
| sp|B8GEI1|CIMA_METPE | Putative (R)-citramalate synthase CimA OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=cimA PE=3 SV=1 | 44 | 396 | 7.0E-47 |
| sp|Q9UZ08|LEU1_PYRAB | 2-isopropylmalate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuA PE=3 SV=1 | 47 | 410 | 2.0E-46 |
| sp|E1R5X1|LEU1_SPISS | 2-isopropylmalate synthase OS=Spirochaeta smaragdinae (strain DSM 11293 / JCM 15392 / SEBR 4228) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-46 |
| sp|B9DMJ6|LEU1_STACT | 2-isopropylmalate synthase OS=Staphylococcus carnosus (strain TM300) GN=leuA PE=3 SV=1 | 42 | 398 | 2.0E-46 |
| sp|Q8TYM1|CIMA_METKA | Putative (R)-citramalate synthase CimA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cimA PE=3 SV=1 | 45 | 406 | 7.0E-46 |
| sp|Q8EN67|LEU1_OCEIH | 2-isopropylmalate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuA PE=3 SV=1 | 42 | 404 | 1.0E-45 |
| sp|Q8U2A2|LEU1_PYRFU | 2-isopropylmalate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuA PE=3 SV=1 | 44 | 396 | 7.0E-45 |
| sp|Q8TKQ6|AKSA_METAC | Putative homocitrate synthase AksA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aksA PE=3 SV=1 | 45 | 396 | 8.0E-45 |
| sp|C5D5M0|LEU1_GEOSW | 2-isopropylmalate synthase OS=Geobacillus sp. (strain WCH70) GN=leuA PE=3 SV=1 | 42 | 395 | 3.0E-44 |
| sp|Q5KWJ3|LEU1_GEOKA | 2-isopropylmalate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=leuA PE=3 SV=1 | 42 | 395 | 6.0E-44 |
| sp|Q8TJJ1|CIMA_METAC | Putative (R)-citramalate synthase CimA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cimA PE=3 SV=1 | 52 | 406 | 7.0E-44 |
| sp|B0TCR1|LEU1_HELMI | 2-isopropylmalate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuA PE=3 SV=1 | 44 | 409 | 8.0E-44 |
| sp|A4IRH8|LEU1_GEOTN | 2-isopropylmalate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuA PE=3 SV=1 | 42 | 395 | 9.0E-44 |
| sp|A8FFW5|LEU11_BACP2 | 2-isopropylmalate synthase 1 OS=Bacillus pumilus (strain SAFR-032) GN=leuA1 PE=3 SV=1 | 42 | 409 | 2.0E-43 |
| sp|Q49Z12|LEU1_STAS1 | 2-isopropylmalate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuA PE=3 SV=1 | 45 | 417 | 3.0E-43 |
| sp|P58967|AKSA_METMA | Putative homocitrate synthase AksA OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aksA PE=3 SV=1 | 45 | 392 | 4.0E-43 |
| sp|Q8RL85|LEU1_GEOSE | 2-isopropylmalate synthase OS=Geobacillus stearothermophilus GN=leuA PE=3 SV=1 | 45 | 395 | 5.0E-43 |
| sp|Q7UI51|LEU1_RHOBA | 2-isopropylmalate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuA PE=3 SV=2 | 44 | 396 | 5.0E-43 |
| sp|A7Z7B8|LEU1_BACMF | 2-isopropylmalate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuA PE=3 SV=1 | 42 | 436 | 1.0E-42 |
| sp|A3CUF2|CIMA_METMJ | Putative (R)-citramalate synthase CimA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=cimA PE=3 SV=1 | 45 | 406 | 2.0E-42 |
| sp|B4SI67|LEU1_STRM5 | 2-isopropylmalate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=leuA PE=3 SV=1 | 44 | 406 | 2.0E-42 |
| sp|Q5WEN3|LEU1_BACSK | 2-isopropylmalate synthase OS=Bacillus clausii (strain KSM-K16) GN=leuA PE=3 SV=1 | 42 | 404 | 3.0E-42 |
| sp|Q4L7U0|LEU1_STAHJ | 2-isopropylmalate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuA PE=3 SV=1 | 45 | 410 | 4.0E-42 |
| sp|B8DBU4|LEU1_LISMH | 2-isopropylmalate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuA PE=3 SV=1 | 42 | 409 | 4.0E-42 |
| sp|Q8Y5R9|LEU1_LISMO | 2-isopropylmalate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuA PE=3 SV=1 | 42 | 398 | 7.0E-42 |
| sp|Q8ZW35|LEU1_PYRAE | Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 | 68 | 387 | 1.0E-41 |
| sp|B8I1T7|LEU1_CLOCE | 2-isopropylmalate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=leuA PE=3 SV=1 | 45 | 403 | 1.0E-41 |
| sp|C0Z9C8|LEU1_BREBN | 2-isopropylmalate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=leuA PE=3 SV=1 | 45 | 404 | 2.0E-41 |
| sp|Q71Y35|LEU1_LISMF | 2-isopropylmalate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuA PE=1 SV=1 | 42 | 398 | 2.0E-41 |
| sp|C1KWT1|LEU1_LISMC | 2-isopropylmalate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuA PE=3 SV=1 | 42 | 398 | 2.0E-41 |
| sp|P23122|NIFV_AZOCH | Homocitrate synthase OS=Azotobacter chroococcum mcd 1 GN=nifV PE=3 SV=1 | 47 | 421 | 2.0E-41 |
| sp|B1HR98|LEU1_LYSSC | 2-isopropylmalate synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=leuA PE=3 SV=1 | 42 | 396 | 2.0E-41 |
| sp|B8E2W9|LEU1_DICTD | 2-isopropylmalate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=leuA PE=3 SV=1 | 42 | 396 | 2.0E-41 |
| sp|A0AK92|LEU1_LISW6 | 2-isopropylmalate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuA PE=3 SV=1 | 42 | 398 | 3.0E-41 |
| sp|P58900|LEU1_XANAC | 2-isopropylmalate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuA PE=3 SV=1 | 44 | 406 | 3.0E-41 |
| sp|Q3BPJ9|LEU1_XANC5 | 2-isopropylmalate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuA PE=3 SV=1 | 44 | 406 | 3.0E-41 |
| sp|Q92A28|LEU1_LISIN | 2-isopropylmalate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuA PE=3 SV=1 | 42 | 398 | 6.0E-41 |
| sp|A6Q4V5|LEU1_NITSB | 2-isopropylmalate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=leuA PE=3 SV=1 | 46 | 404 | 7.0E-41 |
| sp|P58966|CIMA_METMA | Putative (R)-citramalate synthase CimA OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cimA PE=3 SV=1 | 52 | 396 | 1.0E-40 |
| sp|P58637|NIFV2_NOSS1 | Homocitrate synthase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifV2 PE=3 SV=1 | 42 | 354 | 1.0E-40 |
| sp|B2FT78|LEU1_STRMK | 2-isopropylmalate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=leuA PE=3 SV=1 | 44 | 406 | 1.0E-40 |
| sp|C4XPA8|LEU1_DESMR | 2-isopropylmalate synthase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=leuA PE=3 SV=1 | 39 | 404 | 1.0E-40 |
| sp|B9KB95|LEU1_THENN | 2-isopropylmalate synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=leuA PE=3 SV=1 | 42 | 404 | 5.0E-40 |
| sp|A0RQK7|LEU1_CAMFF | 2-isopropylmalate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuA PE=3 SV=1 | 47 | 404 | 5.0E-40 |
| sp|B1L8U2|LEU1_THESQ | 2-isopropylmalate synthase OS=Thermotoga sp. (strain RQ2) GN=leuA PE=3 SV=1 | 42 | 404 | 6.0E-40 |
| sp|Q9WZ23|LEU1_THEMA | 2-isopropylmalate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuA PE=3 SV=1 | 42 | 404 | 6.0E-40 |
| sp|Q9FG67|MAM1_ARATH | Methylthioalkylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=MAM1 PE=1 SV=1 | 15 | 434 | 8.0E-40 |
| sp|Q2P761|LEU1_XANOM | 2-isopropylmalate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuA PE=3 SV=1 | 45 | 406 | 8.0E-40 |
| sp|Q3AEQ5|LEU1_CARHZ | 2-isopropylmalate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuA PE=3 SV=1 | 42 | 396 | 8.0E-40 |
| sp|Q97W36|LEU1_SULSO | Probable 2-isopropylmalate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuA PE=3 SV=1 | 72 | 408 | 9.0E-40 |
| sp|P94565|LEU1_BACSU | 2-isopropylmalate synthase OS=Bacillus subtilis (strain 168) GN=leuA PE=3 SV=1 | 42 | 396 | 2.0E-39 |
| sp|A5IJM2|LEU1_THEP1 | 2-isopropylmalate synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=leuA PE=3 SV=1 | 42 | 404 | 2.0E-39 |
| sp|Q39891|LEU1_SOYBN | Probable 2-isopropylmalate synthase OS=Glycine max GN=GMN56 PE=2 SV=1 | 17 | 413 | 2.0E-39 |
| sp|B3DX88|LEU1_METI4 | 2-isopropylmalate synthase OS=Methylacidiphilum infernorum (isolate V4) GN=leuA PE=3 SV=1 | 44 | 404 | 3.0E-39 |
| sp|B5YEF4|LEU1_DICT6 | 2-isopropylmalate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=leuA PE=3 SV=1 | 42 | 396 | 3.0E-39 |
| sp|Q65GI8|LEU1_BACLD | 2-isopropylmalate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuA PE=3 SV=1 | 42 | 436 | 3.0E-39 |
| sp|Q5WQ01|LEU1_BUCCC | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuA PE=3 SV=1 | 47 | 398 | 4.0E-39 |
| sp|A4YZ76|LEU1_BRASO | 2-isopropylmalate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=leuA PE=3 SV=1 | 29 | 406 | 5.0E-39 |
| sp|B8DM91|LEU1_DESVM | 2-isopropylmalate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuA PE=3 SV=1 | 43 | 396 | 1.0E-38 |
| sp|Q5H4C6|LEU1_XANOR | 2-isopropylmalate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuA PE=3 SV=1 | 45 | 406 | 2.0E-38 |
| sp|Q8CNL3|LEU1_STAES | 2-isopropylmalate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuA PE=3 SV=1 | 45 | 396 | 2.0E-38 |
| sp|Q5HMF9|LEU1_STAEQ | 2-isopropylmalate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuA PE=3 SV=1 | 45 | 396 | 2.0E-38 |
| sp|B1H0A7|LEU1_UNCTG | 2-isopropylmalate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuA PE=3 SV=1 | 49 | 404 | 4.0E-38 |
| sp|P05345|NIFV_KLEPN | Homocitrate synthase OS=Klebsiella pneumoniae GN=nifV PE=3 SV=2 | 44 | 396 | 5.0E-38 |
| sp|D3HCJ2|LEU1_STRG3 | 2-isopropylmalate synthase OS=Streptococcus gallolyticus (strain UCN34) GN=leuA PE=3 SV=1 | 42 | 406 | 6.0E-38 |
| sp|B1XLQ9|LEU1_SYNP2 | 2-isopropylmalate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuA PE=3 SV=1 | 44 | 410 | 8.0E-38 |
| sp|Q89GB0|LEU1_BRADU | 2-isopropylmalate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuA PE=3 SV=1 | 40 | 396 | 9.0E-38 |
| sp|O85063|LEU1_BUCAP | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-37 |
| sp|B8CX21|LEU1_HALOH | 2-isopropylmalate synthase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuA PE=3 SV=1 | 42 | 396 | 1.0E-37 |
| sp|Q7M9W4|LEU1_WOLSU | 2-isopropylmalate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuA PE=3 SV=1 | 45 | 404 | 1.0E-37 |
| sp|Q8VX04|MAM2_ARATH | Methylthioalkylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=MAM2 PE=2 SV=1 | 15 | 434 | 1.0E-37 |
| sp|B1ZDN3|LEU1_METPB | 2-isopropylmalate synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-37 |
| sp|Q07PI3|LEU1_RHOP5 | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=leuA PE=3 SV=1 | 38 | 396 | 2.0E-37 |
| sp|O85070|LEU1_BUCDN | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuA PE=3 SV=1 | 47 | 403 | 3.0E-37 |
| sp|P58901|LEU1_XANCP | 2-isopropylmalate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuA PE=3 SV=1 | 45 | 406 | 3.0E-37 |
| sp|B0RP28|LEU1_XANCB | 2-isopropylmalate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=leuA PE=3 SV=1 | 45 | 406 | 3.0E-37 |
| sp|Q4UYG1|LEU1_XANC8 | 2-isopropylmalate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuA PE=3 SV=1 | 45 | 406 | 3.0E-37 |
| sp|Q9LPR4|LEU11_ARATH | 2-isopropylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=IPMS1 PE=1 SV=2 | 35 | 408 | 6.0E-37 |
| sp|Q2NVW3|LEU1_SODGM | 2-isopropylmalate synthase OS=Sodalis glossinidius (strain morsitans) GN=leuA PE=3 SV=1 | 47 | 403 | 6.0E-37 |
| sp|Q2LWJ3|LEU1_SYNAS | 2-isopropylmalate synthase OS=Syntrophus aciditrophicus (strain SB) GN=leuA PE=3 SV=1 | 44 | 409 | 7.0E-37 |
| sp|Q9FN52|MAM3_ARATH | Methylthioalkylmalate synthase 3, chloroplastic OS=Arabidopsis thaliana GN=MAM3 PE=1 SV=1 | 10 | 406 | 9.0E-37 |
| sp|Q2YBW0|LEU1_NITMU | 2-isopropylmalate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuA PE=3 SV=1 | 47 | 419 | 9.0E-37 |
| sp|A4J181|LEU1_DESRM | 2-isopropylmalate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=leuA PE=3 SV=1 | 44 | 396 | 1.0E-36 |
| sp|Q9C550|LEU12_ARATH | 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=IPMS2 PE=1 SV=1 | 20 | 408 | 1.0E-36 |
| sp|A7I0N8|LEU1_CAMHC | 2-isopropylmalate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuA PE=3 SV=1 | 41 | 404 | 1.0E-36 |
| sp|P58899|LEU1_STAAW | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain MW2) GN=leuA PE=3 SV=1 | 44 | 410 | 1.0E-36 |
| sp|Q6G7Q1|LEU1_STAAS | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain MSSA476) GN=leuA PE=3 SV=1 | 44 | 410 | 1.0E-36 |
| sp|B1I1Y1|LEU1_DESAP | 2-isopropylmalate synthase OS=Desulforudis audaxviator (strain MP104C) GN=leuA PE=3 SV=1 | 44 | 409 | 2.0E-36 |
| sp|A8Z4W0|LEU1_STAAT | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|A6QIQ3|LEU1_STAAE | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain Newman) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|Q5HEE4|LEU1_STAAC | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain COL) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|Q2FWK3|LEU1_STAA8 | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|Q2FF67|LEU1_STAA3 | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain USA300) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|A9BB43|LEU1_PROM4 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=leuA PE=3 SV=1 | 43 | 409 | 2.0E-36 |
| sp|B4F194|LEU1_PROMH | 2-isopropylmalate synthase OS=Proteus mirabilis (strain HI4320) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-36 |
| sp|Q6GF16|LEU1_STAAR | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain MRSA252) GN=leuA PE=3 SV=1 | 44 | 410 | 2.0E-36 |
| sp|A7GMU1|LEU1_BACCN | 2-isopropylmalate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuA PE=3 SV=1 | 47 | 406 | 3.0E-36 |
| sp|Q9PCG3|LEU1_XYLFA | 2-isopropylmalate synthase OS=Xylella fastidiosa (strain 9a5c) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-36 |
| sp|A5EP79|LEU1_BRASB | 2-isopropylmalate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=leuA PE=3 SV=1 | 40 | 409 | 4.0E-36 |
| sp|D3EBC1|LEU1_GEOS4 | 2-isopropylmalate synthase OS=Geobacillus sp. (strain Y412MC10) GN=leuA PE=3 SV=1 | 47 | 403 | 4.0E-36 |
| sp|P48571|LEU1_BUCRP | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuA PE=3 SV=1 | 47 | 403 | 4.0E-36 |
| sp|P63477|LEU1_STAAN | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain N315) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-36 |
| sp|P63476|LEU1_STAAM | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-36 |
| sp|A5IUK3|LEU1_STAA9 | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain JH9) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-36 |
| sp|A6U3E2|LEU1_STAA2 | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain JH1) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-36 |
| sp|A7X4N1|LEU1_STAA1 | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=leuA PE=3 SV=1 | 44 | 410 | 5.0E-36 |
| sp|Q212A9|LEU1_RHOPB | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuA PE=3 SV=1 | 40 | 406 | 5.0E-36 |
| sp|Q89A49|LEU1_BUCBP | Putative 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuA PE=5 SV=1 | 47 | 396 | 6.0E-36 |
| sp|Q7VBG1|LEU1_PROMA | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuA PE=3 SV=1 | 43 | 409 | 6.0E-36 |
| sp|Q2YUF2|LEU1_STAAB | 2-isopropylmalate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuA PE=3 SV=1 | 44 | 410 | 7.0E-36 |
| sp|Q52070|NIFV_ENTAG | Homocitrate synthase OS=Enterobacter agglomerans GN=nifV PE=3 SV=1 | 47 | 396 | 8.0E-36 |
| sp|B8IHS8|LEU1_METNO | 2-isopropylmalate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=leuA PE=3 SV=1 | 40 | 404 | 8.0E-36 |
| sp|Q7VQJ6|LEU1_BLOFL | 2-isopropylmalate synthase OS=Blochmannia floridanus GN=leuA PE=3 SV=1 | 47 | 398 | 1.0E-35 |
| sp|Q3J877|LEU1_NITOC | 2-isopropylmalate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuA PE=3 SV=1 | 44 | 404 | 1.0E-35 |
| sp|A3DF94|LEU1_CLOTH | 2-isopropylmalate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuA PE=3 SV=1 | 42 | 409 | 1.0E-35 |
| sp|Q7P0H2|LEU1_CHRVO | 2-isopropylmalate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuA PE=3 SV=1 | 44 | 417 | 1.0E-35 |
| sp|Q0AGN5|LEU1_NITEC | 2-isopropylmalate synthase OS=Nitrosomonas eutropha (strain C91) GN=leuA PE=3 SV=1 | 44 | 404 | 1.0E-35 |
| sp|Q87CL8|LEU1_XYLFT | 2-isopropylmalate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuA PE=3 SV=1 | 45 | 403 | 2.0E-35 |
| sp|B2I596|LEU1_XYLF2 | 2-isopropylmalate synthase OS=Xylella fastidiosa (strain M23) GN=leuA PE=3 SV=1 | 45 | 403 | 2.0E-35 |
| sp|B0JGK2|LEU1_MICAN | 2-isopropylmalate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=leuA PE=3 SV=1 | 44 | 416 | 2.0E-35 |
| sp|Q138Z2|LEU1_RHOPS | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=leuA PE=3 SV=1 | 40 | 404 | 2.0E-35 |
| sp|B2JDN6|LEU1_BURP8 | 2-isopropylmalate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuA PE=3 SV=1 | 44 | 408 | 2.0E-35 |
| sp|Q9JZG1|LEU1_NEIMB | 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuA PE=1 SV=1 | 39 | 404 | 2.0E-35 |
| sp|Q605K7|LEU1_METCA | 2-isopropylmalate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuA PE=3 SV=1 | 44 | 396 | 2.0E-35 |
| sp|P58898|LEU1_BUCPS | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuA PE=3 SV=1 | 47 | 376 | 2.0E-35 |
| sp|P48576|LEU1_SYNY3 | 2-isopropylmalate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuA PE=3 SV=1 | 40 | 409 | 2.0E-35 |
| sp|B2SNG9|LEU1_XANOP | 2-isopropylmalate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=leuA PE=3 SV=1 | 66 | 406 | 3.0E-35 |
| sp|Q9JUK6|LEU1_NEIMA | 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuA PE=3 SV=1 | 39 | 404 | 3.0E-35 |
| sp|A1KTV6|LEU1_NEIMF | 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuA PE=3 SV=1 | 39 | 404 | 3.0E-35 |
| sp|Q0IBI3|LEU1_SYNS3 | 2-isopropylmalate synthase OS=Synechococcus sp. (strain CC9311) GN=leuA PE=3 SV=1 | 43 | 409 | 3.0E-35 |
| sp|A5MZ76|LEU1_CLOK5 | 2-isopropylmalate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuA PE=3 SV=1 | 44 | 414 | 3.0E-35 |
| sp|B9E371|LEU1_CLOK1 | 2-isopropylmalate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=leuA PE=3 SV=1 | 44 | 414 | 3.0E-35 |
| sp|Q2IUT4|LEU1_RHOP2 | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuA PE=3 SV=1 | 40 | 404 | 3.0E-35 |
| sp|P94907|LEU1_MICAE | 2-isopropylmalate synthase OS=Microcystis aeruginosa GN=leuA PE=3 SV=1 | 44 | 416 | 3.0E-35 |
| sp|A8ES07|LEU1_ARCB4 | 2-isopropylmalate synthase OS=Arcobacter butzleri (strain RM4018) GN=leuA PE=3 SV=1 | 47 | 436 | 4.0E-35 |
| sp|Q7NI93|LEU1_GLOVI | 2-isopropylmalate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuA PE=3 SV=1 | 44 | 409 | 4.0E-35 |
| sp|A6LDN1|LEU1_PARD8 | 2-isopropylmalate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=leuA PE=3 SV=1 | 44 | 409 | 4.0E-35 |
| sp|Q02YX5|LEU1_LACLS | 2-isopropylmalate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=leuA PE=3 SV=1 | 42 | 406 | 4.0E-35 |
| sp|O66682|CIMA_AQUAE | (R)-citramalate synthase OS=Aquifex aeolicus (strain VF5) GN=cimA PE=3 SV=1 | 47 | 394 | 5.0E-35 |
| sp|P43861|LEU1_HAEIN | 2-isopropylmalate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuA PE=3 SV=1 | 44 | 403 | 5.0E-35 |
| sp|A0RBL2|LEU1_BACAH | 2-isopropylmalate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=leuA PE=3 SV=1 | 42 | 396 | 5.0E-35 |
| sp|B1YTR7|LEU1_BURA4 | 2-isopropylmalate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=leuA PE=3 SV=1 | 44 | 408 | 6.0E-35 |
| sp|B3QCX5|LEU1_RHOPT | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuA PE=3 SV=1 | 40 | 404 | 6.0E-35 |
| sp|Q6N858|LEU1_RHOPA | 2-isopropylmalate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuA PE=3 SV=1 | 40 | 404 | 7.0E-35 |
| sp|Q63DX8|LEU1_BACCZ | 2-isopropylmalate synthase OS=Bacillus cereus (strain ZK / E33L) GN=leuA PE=3 SV=1 | 42 | 396 | 7.0E-35 |
| sp|Q5F8D4|LEU1_NEIG1 | 2-isopropylmalate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuA PE=3 SV=1 | 39 | 404 | 8.0E-35 |
| sp|Q0BDB9|LEU1_BURCM | 2-isopropylmalate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuA PE=3 SV=1 | 44 | 408 | 8.0E-35 |
| sp|A9VLG7|LEU1_BACWK | 2-isopropylmalate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuA PE=3 SV=1 | 47 | 406 | 8.0E-35 |
| sp|Q7N129|LEU1_PHOLL | 2-isopropylmalate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuA PE=3 SV=1 | 47 | 403 | 8.0E-35 |
| sp|B7JYP4|LEU1_CYAP8 | 2-isopropylmalate synthase OS=Cyanothece sp. (strain PCC 8801) GN=leuA PE=3 SV=1 | 44 | 396 | 8.0E-35 |
| sp|B5Y1W2|LEU1_KLEP3 | 2-isopropylmalate synthase OS=Klebsiella pneumoniae (strain 342) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-35 |
| sp|Q112U2|LEU1_TRIEI | 2-isopropylmalate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=leuA PE=3 SV=1 | 44 | 411 | 9.0E-35 |
| sp|C1EMA9|LEU1_BACC3 | 2-isopropylmalate synthase OS=Bacillus cereus (strain 03BB102) GN=leuA PE=3 SV=1 | 47 | 396 | 9.0E-35 |
| sp|Q820M0|LEU1_NITEU | 2-isopropylmalate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuA PE=3 SV=1 | 47 | 396 | 1.0E-34 |
| sp|Q5NXN2|LEU1_AROAE | 2-isopropylmalate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=leuA PE=3 SV=1 | 47 | 396 | 1.0E-34 |
| sp|A6T4L9|LEU1_KLEP7 | 2-isopropylmalate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-34 |
| sp|A4JGE0|LEU1_BURVG | 2-isopropylmalate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuA PE=3 SV=1 | 44 | 408 | 1.0E-34 |
| sp|A4W6H9|LEU1_ENT38 | 2-isopropylmalate synthase OS=Enterobacter sp. (strain 638) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-34 |
| sp|A7ZES2|LEU1_CAMC1 | 2-isopropylmalate synthase OS=Campylobacter concisus (strain 13826) GN=leuA PE=3 SV=1 | 47 | 404 | 1.0E-34 |
| sp|A8G9R1|LEU1_SERP5 | 2-isopropylmalate synthase OS=Serratia proteamaculans (strain 568) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-34 |
| sp|Q47BI0|LEU1_DECAR | 2-isopropylmalate synthase OS=Dechloromonas aromatica (strain RCB) GN=leuA PE=3 SV=1 | 47 | 396 | 1.0E-34 |
| sp|A5UD85|LEU1_HAEIE | 2-isopropylmalate synthase OS=Haemophilus influenzae (strain PittEE) GN=leuA PE=3 SV=1 | 44 | 403 | 1.0E-34 |
| sp|P54610|NIFV_FRASP | Homocitrate synthase OS=Frankia sp. (strain FaC1) GN=nifV PE=3 SV=1 | 46 | 406 | 2.0E-34 |
| sp|B7JFY5|LEU1_BACC0 | 2-isopropylmalate synthase OS=Bacillus cereus (strain AH820) GN=leuA PE=3 SV=1 | 47 | 396 | 2.0E-34 |
| sp|Q4QLS4|LEU1_HAEI8 | 2-isopropylmalate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=leuA PE=3 SV=1 | 44 | 403 | 2.0E-34 |
| sp|A0K933|LEU1_BURCH | 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=leuA PE=3 SV=1 | 44 | 408 | 2.0E-34 |
| sp|B1JVQ1|LEU1_BURCC | 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=leuA PE=3 SV=1 | 44 | 408 | 2.0E-34 |
| sp|Q1BV03|LEU1_BURCA | 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=leuA PE=3 SV=1 | 44 | 408 | 2.0E-34 |
| sp|Q9ZEY8|LEU1_BUCAI | 2-isopropylmalate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuA PE=3 SV=3 | 47 | 403 | 2.0E-34 |
| sp|Q6HLF3|LEU1_BACHK | 2-isopropylmalate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuA PE=3 SV=1 | 47 | 396 | 2.0E-34 |
| sp|Q1QJV3|LEU1_NITHX | 2-isopropylmalate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=leuA PE=3 SV=1 | 40 | 396 | 3.0E-34 |
| sp|Q39ED5|LEU1_BURL3 | 2-isopropylmalate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuA PE=3 SV=1 | 44 | 408 | 3.0E-34 |
| sp|B4E5N2|LEU1_BURCJ | 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=leuA PE=3 SV=1 | 44 | 408 | 3.0E-34 |
| sp|A0KGM9|LEU1_AERHH | 2-isopropylmalate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-34 |
| sp|Q0I2G1|LEU1_HAES1 | 2-isopropylmalate synthase OS=Haemophilus somnus (strain 129Pt) GN=leuA PE=3 SV=1 | 47 | 403 | 3.0E-34 |
| sp|B7KJX8|LEU1_CYAP7 | 2-isopropylmalate synthase OS=Cyanothece sp. (strain PCC 7424) GN=leuA PE=3 SV=1 | 44 | 409 | 4.0E-34 |
| sp|Q3SHE7|LEU1_THIDA | 2-isopropylmalate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuA PE=3 SV=1 | 44 | 404 | 4.0E-34 |
| sp|B0USF6|LEU1_HISS2 | 2-isopropylmalate synthase OS=Histophilus somni (strain 2336) GN=leuA PE=3 SV=1 | 47 | 403 | 4.0E-34 |
| sp|B6ELK0|LEU1_ALISL | 2-isopropylmalate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=leuA PE=3 SV=1 | 47 | 403 | 4.0E-34 |
| sp|B1WQQ4|LEU1_CYAA5 | 2-isopropylmalate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=leuA PE=3 SV=1 | 47 | 409 | 4.0E-34 |
| sp|B9IUZ0|LEU1_BACCQ | 2-isopropylmalate synthase OS=Bacillus cereus (strain Q1) GN=leuA PE=3 SV=1 | 47 | 396 | 5.0E-34 |
| sp|Q73BA0|LEU1_BACC1 | 2-isopropylmalate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuA PE=3 SV=1 | 47 | 396 | 5.0E-34 |
| sp|A9MQD8|LEU1_SALAR | 2-isopropylmalate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuA PE=3 SV=1 | 47 | 403 | 5.0E-34 |
| sp|Q493R0|LEU1_BLOPB | 2-isopropylmalate synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuA PE=3 SV=1 | 47 | 403 | 5.0E-34 |
| sp|Q6D0G8|LEU1_PECAS | 2-isopropylmalate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuA PE=3 SV=1 | 47 | 403 | 5.0E-34 |
| sp|C6DEV8|LEU1_PECCP | 2-isopropylmalate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuA PE=3 SV=1 | 47 | 403 | 6.0E-34 |
| sp|A1JJH7|LEU1_YERE8 | 2-isopropylmalate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuA PE=3 SV=1 | 47 | 403 | 6.0E-34 |
| sp|Q63VP3|LEU1_BURPS | 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain K96243) GN=leuA PE=3 SV=1 | 44 | 408 | 6.0E-34 |
| sp|A3N7K7|LEU1_BURP6 | 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 668) GN=leuA PE=3 SV=1 | 44 | 408 | 6.0E-34 |
| sp|Q3JUB9|LEU1_BURP1 | 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=leuA PE=3 SV=1 | 44 | 408 | 6.0E-34 |
| sp|A3NT94|LEU1_BURP0 | 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=leuA PE=3 SV=1 | 44 | 408 | 6.0E-34 |
| sp|Q0HE65|LEU1_SHESM | 2-isopropylmalate synthase OS=Shewanella sp. (strain MR-4) GN=leuA PE=3 SV=1 | 44 | 403 | 7.0E-34 |
| sp|A4SXR0|LEU1_POLSQ | 2-isopropylmalate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuA PE=3 SV=1 | 47 | 404 | 7.0E-34 |
| sp|A0L1R0|LEU1_SHESA | 2-isopropylmalate synthase OS=Shewanella sp. (strain ANA-3) GN=leuA PE=3 SV=1 | 44 | 403 | 7.0E-34 |
| sp|A5GRZ0|LEU1_SYNR3 | 2-isopropylmalate synthase OS=Synechococcus sp. (strain RCC307) GN=leuA PE=3 SV=1 | 43 | 411 | 8.0E-34 |
| sp|B1XUJ3|LEU1_POLNS | 2-isopropylmalate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuA PE=3 SV=1 | 47 | 404 | 8.0E-34 |
| sp|B0T0G9|LEU1_CAUSK | 2-isopropylmalate synthase OS=Caulobacter sp. (strain K31) GN=leuA PE=3 SV=1 | 47 | 404 | 1.0E-33 |
| sp|A7MIC5|LEU1_CROS8 | 2-isopropylmalate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|A9KY13|LEU1_SHEB9 | 2-isopropylmalate synthase OS=Shewanella baltica (strain OS195) GN=leuA PE=3 SV=1 | 44 | 403 | 1.0E-33 |
| sp|B1JK98|LEU1_YERPY | 2-isopropylmalate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q66EM1|LEU1_YERPS | 2-isopropylmalate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|A4TQA2|LEU1_YERPP | 2-isopropylmalate synthase OS=Yersinia pestis (strain Pestoides F) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q1CMP5|LEU1_YERPN | 2-isopropylmalate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|A9R142|LEU1_YERPG | 2-isopropylmalate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q8ZIG8|LEU1_YERPE | 2-isopropylmalate synthase OS=Yersinia pestis GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|B2K4C9|LEU1_YERPB | 2-isopropylmalate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q1C1Z6|LEU1_YERPA | 2-isopropylmalate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|A7FM84|LEU1_YERP3 | 2-isopropylmalate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q8XXP1|LEU11_RALSO | 2-isopropylmalate synthase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=leuA1 PE=3 SV=1 | 44 | 404 | 1.0E-33 |
| sp|B4SU36|LEU1_SALNS | 2-isopropylmalate synthase OS=Salmonella newport (strain SL254) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|B5FGH4|LEU1_VIBFM | 2-isopropylmalate synthase OS=Vibrio fischeri (strain MJ11) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-33 |
| sp|Q8E9N2|LEU1_SHEON | 2-isopropylmalate synthase OS=Shewanella oneidensis (strain MR-1) GN=leuA PE=3 SV=1 | 44 | 403 | 1.0E-33 |
| sp|C0Q5H1|LEU1_SALPC | 2-isopropylmalate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|Q57TE6|LEU1_SALCH | 2-isopropylmalate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|Q5E856|LEU1_VIBF1 | 2-isopropylmalate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|A3PDH0|LEU1_PROM0 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuA PE=3 SV=1 | 41 | 409 | 2.0E-33 |
| sp|Q8DJ32|LEU1_THEEB | 2-isopropylmalate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuA PE=3 SV=1 | 44 | 396 | 2.0E-33 |
| sp|P15875|LEU1_SALTY | 2-isopropylmalate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuA PE=3 SV=4 | 47 | 403 | 2.0E-33 |
| sp|B4TWW1|LEU1_SALSV | 2-isopropylmalate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|A9MZK0|LEU1_SALPB | 2-isopropylmalate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|B4TJ72|LEU1_SALHS | 2-isopropylmalate synthase OS=Salmonella heidelberg (strain SL476) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|B5RGE4|LEU1_SALG2 | 2-isopropylmalate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|B5R2K9|LEU1_SALEP | 2-isopropylmalate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|B5FI58|LEU1_SALDC | 2-isopropylmalate synthase OS=Salmonella dublin (strain CT_02021853) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|B5BLB5|LEU1_SALPK | 2-isopropylmalate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|Q5PDG1|LEU1_SALPA | 2-isopropylmalate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-33 |
| sp|A1WNY5|LEU1_VEREI | 2-isopropylmalate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-33 |
| sp|B5F7U9|LEU1_SALA4 | 2-isopropylmalate synthase OS=Salmonella agona (strain SL483) GN=leuA PE=3 SV=1 | 47 | 403 | 3.0E-33 |
| sp|Q0HZT4|LEU1_SHESR | 2-isopropylmalate synthase OS=Shewanella sp. (strain MR-7) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-33 |
| sp|A1REY0|LEU1_SHESW | 2-isopropylmalate synthase OS=Shewanella sp. (strain W3-18-1) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-33 |
| sp|A4Y2M0|LEU1_SHEPC | 2-isopropylmalate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-33 |
| sp|A6WIB5|LEU1_SHEB8 | 2-isopropylmalate synthase OS=Shewanella baltica (strain OS185) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-33 |
| sp|Q473V1|LEU1_CUPPJ | 2-isopropylmalate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuA PE=3 SV=1 | 44 | 404 | 3.0E-33 |
| sp|Q81T68|LEU1_BACAN | 2-isopropylmalate synthase OS=Bacillus anthracis GN=leuA PE=3 SV=1 | 47 | 396 | 3.0E-33 |
| sp|C3L9Q7|LEU1_BACAC | 2-isopropylmalate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuA PE=3 SV=1 | 47 | 396 | 3.0E-33 |
| sp|C3P4Z6|LEU1_BACAA | 2-isopropylmalate synthase OS=Bacillus anthracis (strain A0248) GN=leuA PE=3 SV=1 | 47 | 396 | 3.0E-33 |
| sp|Q8Z9I0|LEU1_SALTI | 2-isopropylmalate synthase OS=Salmonella typhi GN=leuA PE=3 SV=3 | 47 | 403 | 3.0E-33 |
| sp|Q7U892|LEU1_SYNPX | 2-isopropylmalate synthase OS=Synechococcus sp. (strain WH8102) GN=leuA PE=3 SV=1 | 43 | 409 | 3.0E-33 |
| sp|Q07WG9|LEU1_SHEFN | 2-isopropylmalate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-33 |
| sp|A5GM47|LEU1_SYNPW | 2-isopropylmalate synthase OS=Synechococcus sp. (strain WH7803) GN=leuA PE=3 SV=1 | 43 | 409 | 4.0E-33 |
| sp|C4LAV7|LEU1_TOLAT | 2-isopropylmalate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=leuA PE=3 SV=1 | 44 | 418 | 4.0E-33 |
| sp|A3CZK5|LEU1_SHEB5 | 2-isopropylmalate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-33 |
| sp|A1S2E0|LEU1_SHEAM | 2-isopropylmalate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-33 |
| sp|O04973|LEU1A_SOLPN | 2-isopropylmalate synthase A OS=Solanum pennellii GN=IPMSA PE=2 SV=1 | 26 | 404 | 4.0E-33 |
| sp|Q31AF9|LEU1_PROM9 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuA PE=3 SV=1 | 43 | 409 | 4.0E-33 |
| sp|A2BRP4|LEU1_PROMS | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain AS9601) GN=leuA PE=3 SV=1 | 43 | 409 | 4.0E-33 |
| sp|B0TQM0|LEU1_SHEHH | 2-isopropylmalate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-33 |
| sp|A8H9A1|LEU1_SHEPA | 2-isopropylmalate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-33 |
| sp|Q3Z5T6|LEU1_SHISS | 2-isopropylmalate synthase OS=Shigella sonnei (strain Ss046) GN=leuA PE=3 SV=1 | 47 | 403 | 5.0E-33 |
| sp|Q46K01|LEU1_PROMT | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=leuA PE=3 SV=1 | 43 | 409 | 6.0E-33 |
| sp|Q3SQ49|LEU1_NITWN | 2-isopropylmalate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuA PE=3 SV=1 | 40 | 408 | 6.0E-33 |
| sp|A8G5D5|LEU1_PROM2 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=leuA PE=3 SV=1 | 43 | 409 | 6.0E-33 |
| sp|A8ALM5|LEU1_CITK8 | 2-isopropylmalate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuA PE=3 SV=1 | 47 | 403 | 6.0E-33 |
| sp|A9AJN4|LEU1_BURM1 | 2-isopropylmalate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuA PE=3 SV=1 | 44 | 408 | 7.0E-33 |
| sp|B2VDA7|LEU1_ERWT9 | 2-isopropylmalate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=leuA PE=3 SV=1 | 47 | 403 | 7.0E-33 |
| sp|Q9CJN5|LEU1_PASMU | 2-isopropylmalate synthase OS=Pasteurella multocida (strain Pm70) GN=leuA PE=3 SV=1 | 47 | 403 | 7.0E-33 |
| sp|A2C3L7|LEU1_PROM1 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=leuA PE=3 SV=1 | 43 | 409 | 8.0E-33 |
| sp|Q9A823|LEU1_CAUCR | 2-isopropylmalate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuA PE=3 SV=1 | 47 | 404 | 8.0E-33 |
| sp|B8H607|LEU1_CAUCN | 2-isopropylmalate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=leuA PE=3 SV=1 | 47 | 404 | 8.0E-33 |
| sp|Q32K20|LEU1_SHIDS | 2-isopropylmalate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuA PE=3 SV=1 | 47 | 403 | 8.0E-33 |
| sp|Q0T8C4|LEU1_SHIF8 | 2-isopropylmalate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=leuA PE=3 SV=1 | 47 | 403 | 8.0E-33 |
| sp|Q326G1|LEU1_SHIBS | 2-isopropylmalate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B2U281|LEU1_SHIB3 | 2-isopropylmalate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|Q1RGC3|LEU1_ECOUT | 2-isopropylmalate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B6HZ24|LEU1_ECOSE | 2-isopropylmalate synthase OS=Escherichia coli (strain SE11) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B1IRA4|LEU1_ECOLC | 2-isopropylmalate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|Q8FL75|LEU1_ECOL6 | 2-isopropylmalate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuA PE=3 SV=3 | 47 | 403 | 9.0E-33 |
| sp|Q0TLR5|LEU1_ECOL5 | 2-isopropylmalate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|A1A7C2|LEU1_ECOK1 | 2-isopropylmalate synthase OS=Escherichia coli O1:K1 / APEC GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|A7ZW25|LEU1_ECOHS | 2-isopropylmalate synthase OS=Escherichia coli O9:H4 (strain HS) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7M119|LEU1_ECO8A | 2-isopropylmalate synthase OS=Escherichia coli O8 (strain IAI1) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7NHI2|LEU1_ECO7I | 2-isopropylmalate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7LFU5|LEU1_ECO55 | 2-isopropylmalate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7MAJ9|LEU1_ECO45 | 2-isopropylmalate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|A7ZHG6|LEU1_ECO24 | 2-isopropylmalate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7N7U9|LEU1_ECOLU | 2-isopropylmalate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B5YZB0|LEU1_ECO5E | 2-isopropylmalate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|Q8X9Z8|LEU1_ECO57 | 2-isopropylmalate synthase OS=Escherichia coli O157:H7 GN=leuA PE=3 SV=3 | 47 | 403 | 9.0E-33 |
| sp|B7LWE2|LEU1_ESCF3 | 2-isopropylmalate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B1LG11|LEU1_ECOSM | 2-isopropylmalate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B7UIC4|LEU1_ECO27 | 2-isopropylmalate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuA PE=3 SV=1 | 47 | 403 | 9.0E-33 |
| sp|B6JB87|LEU1_OLICO | 2-isopropylmalate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuA PE=3 SV=1 | 40 | 396 | 9.0E-33 |
| sp|Q83SP0|LEU1_SHIFL | 2-isopropylmalate synthase OS=Shigella flexneri GN=leuA PE=3 SV=3 | 47 | 403 | 1.0E-32 |
| sp|P09151|LEU1_ECOLI | 2-isopropylmalate synthase OS=Escherichia coli (strain K12) GN=leuA PE=1 SV=5 | 47 | 403 | 1.0E-32 |
| sp|C4ZPZ7|LEU1_ECOBW | 2-isopropylmalate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-32 |
| sp|Q6LV24|LEU1_PHOPR | 2-isopropylmalate synthase OS=Photobacterium profundum GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-32 |
| sp|C3LR32|LEU1_VIBCM | 2-isopropylmalate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-32 |
| sp|Q9KP83|LEU1_VIBCH | 2-isopropylmalate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuA PE=3 SV=1 | 47 | 403 | 1.0E-32 |
| sp|Q7TUV5|LEU1_PROMM | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuA PE=3 SV=1 | 43 | 409 | 1.0E-32 |
| sp|A2C859|LEU1_PROM3 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=leuA PE=3 SV=1 | 43 | 409 | 1.0E-32 |
| sp|A2BX52|LEU1_PROM5 | 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=leuA PE=3 SV=1 | 43 | 409 | 1.0E-32 |
| sp|A5D4W0|LEU1_PELTS | 2-isopropylmalate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=leuA PE=3 SV=1 | 44 | 425 | 1.0E-32 |
| sp|Q31I16|LEU11_THICR | 2-isopropylmalate synthase 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=leuA1 PE=3 SV=1 | 47 | 406 | 1.0E-32 |
| sp|Q01181|NIFV_RHOSH | Homocitrate synthase OS=Rhodobacter sphaeroides GN=nifV PE=3 SV=1 | 33 | 356 | 2.0E-32 |
| sp|Q0KCT8|LEU1_CUPNH | 2-isopropylmalate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-32 |
| sp|A1SRG8|LEU1_PSYIN | 2-isopropylmalate synthase OS=Psychromonas ingrahamii (strain 37) GN=leuA PE=3 SV=1 | 47 | 403 | 2.0E-32 |
| sp|Q8F445|LEU1_LEPIN | 2-isopropylmalate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuA PE=3 SV=2 | 46 | 406 | 2.0E-32 |
| sp|Q72RL9|LEU1_LEPIC | 2-isopropylmalate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuA PE=3 SV=2 | 46 | 406 | 2.0E-32 |
| sp|Q1LPX2|LEU1_CUPMC | 2-isopropylmalate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-32 |
| sp|A4SR62|LEU1_AERS4 | 2-isopropylmalate synthase OS=Aeromonas salmonicida (strain A449) GN=leuA PE=3 SV=1 | 44 | 403 | 2.0E-32 |
| sp|B1XYA8|LEU1_LEPCP | 2-isopropylmalate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=leuA PE=3 SV=1 | 47 | 404 | 3.0E-32 |
| sp|Q12B47|LEU1_POLSJ | 2-isopropylmalate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuA PE=3 SV=1 | 44 | 404 | 3.0E-32 |
| sp|B8E4K4|LEU1_SHEB2 | 2-isopropylmalate synthase OS=Shewanella baltica (strain OS223) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-32 |
| sp|A3QIP0|LEU1_SHELP | 2-isopropylmalate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-32 |
| sp|B8CM39|LEU1_SHEPW | 2-isopropylmalate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=leuA PE=3 SV=1 | 44 | 403 | 3.0E-32 |
| sp|B7MNT2|LEU1_ECO81 | 2-isopropylmalate synthase OS=Escherichia coli O81 (strain ED1a) GN=leuA PE=3 SV=1 | 47 | 403 | 4.0E-32 |
| sp|Q7V121|LEU1_PROMP | 2-isopropylmalate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuA PE=3 SV=1 | 43 | 409 | 4.0E-32 |
| sp|A8FQ83|LEU1_SHESH | 2-isopropylmalate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=leuA PE=3 SV=1 | 44 | 403 | 4.0E-32 |
| sp|Q47884|NIFV_FRAAL | Homocitrate synthase OS=Frankia alni GN=nifV PE=3 SV=1 | 45 | 356 | 6.0E-32 |
| sp|Q07179|NIFV_RHOCA | Homocitrate synthase OS=Rhodobacter capsulatus GN=nifV PE=3 SV=1 | 45 | 395 | 7.0E-32 |
| sp|A1VN06|LEU1_POLNA | 2-isopropylmalate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuA PE=3 SV=1 | 44 | 404 | 8.0E-32 |
| sp|Q87SS7|LEU1_VIBPA | 2-isopropylmalate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuA PE=3 SV=1 | 47 | 376 | 8.0E-32 |
| sp|Q12SE7|LEU1_SHEDO | 2-isopropylmalate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=leuA PE=3 SV=1 | 44 | 409 | 1.0E-31 |
| sp|A1W1X2|LEU1_CAMJJ | 2-isopropylmalate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuA PE=3 SV=1 | 47 | 396 | 1.0E-31 |
| sp|B7VIF2|LEU1_VIBTL | 2-isopropylmalate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=leuA PE=3 SV=1 | 47 | 376 | 1.0E-31 |
| sp|Q02141|LEU1_LACLA | 2-isopropylmalate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuA PE=3 SV=1 | 42 | 384 | 1.0E-31 |
| sp|Q3AYY2|LEU1_SYNS9 | 2-isopropylmalate synthase OS=Synechococcus sp. (strain CC9902) GN=leuA PE=3 SV=1 | 43 | 409 | 1.0E-31 |
| sp|Q21VZ1|LEU1_RHOFT | 2-isopropylmalate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuA PE=3 SV=1 | 47 | 404 | 1.0E-31 |
| sp|Q9PLV9|LEU1_CAMJE | 2-isopropylmalate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuA PE=3 SV=1 | 47 | 396 | 1.0E-31 |
| sp|Q9EVH6|LEU1_BUCUE | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuA PE=3 SV=1 | 54 | 403 | 2.0E-31 |
| sp|A8FP35|LEU1_CAMJ8 | 2-isopropylmalate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuA PE=3 SV=1 | 47 | 396 | 2.0E-31 |
| sp|Q9EVE3|LEU1_BUCUL | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuA PE=3 SV=1 | 68 | 403 | 2.0E-31 |
| sp|Q9WZ22|CIMA_THEMA | (R)-citramalate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cimA PE=3 SV=1 | 46 | 394 | 2.0E-31 |
| sp|Q15QR4|LEU1_PSEA6 | 2-isopropylmalate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=leuA PE=3 SV=1 | 44 | 403 | 2.0E-31 |
| sp|Q3AIA2|LEU1_SYNSC | 2-isopropylmalate synthase OS=Synechococcus sp. (strain CC9605) GN=leuA PE=3 SV=1 | 43 | 409 | 2.0E-31 |
| sp|Q3MBA3|LEU1_ANAVT | 2-isopropylmalate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuA PE=3 SV=1 | 44 | 396 | 2.0E-31 |
| sp|Q5HS76|LEU1_CAMJR | 2-isopropylmalate synthase OS=Campylobacter jejuni (strain RM1221) GN=leuA PE=3 SV=1 | 47 | 396 | 2.0E-31 |
| sp|B1KKZ4|LEU1_SHEWM | 2-isopropylmalate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuA PE=3 SV=1 | 44 | 403 | 2.0E-31 |
| sp|A1TRT4|LEU1_ACIAC | 2-isopropylmalate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=leuA PE=3 SV=1 | 44 | 404 | 2.0E-31 |
| sp|A7H667|LEU1_CAMJD | 2-isopropylmalate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuA PE=3 SV=1 | 47 | 396 | 2.0E-31 |
| sp|O67862|LEU1_AQUAE | 2-isopropylmalate synthase OS=Aquifex aeolicus (strain VF5) GN=leuA PE=3 SV=2 | 47 | 419 | 3.0E-31 |
| sp|P48575|LEU1_NOSS1 | 2-isopropylmalate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuA PE=3 SV=2 | 47 | 396 | 3.0E-31 |
| sp|B9MA32|LEU1_ACIET | 2-isopropylmalate synthase OS=Acidovorax ebreus (strain TPSY) GN=leuA PE=3 SV=1 | 44 | 404 | 3.0E-31 |
| sp|A1W6T7|LEU1_ACISJ | 2-isopropylmalate synthase OS=Acidovorax sp. (strain JS42) GN=leuA PE=3 SV=1 | 44 | 404 | 3.0E-31 |
| sp|Q7MP77|LEU1_VIBVY | 2-isopropylmalate synthase OS=Vibrio vulnificus (strain YJ016) GN=leuA PE=3 SV=1 | 47 | 376 | 3.0E-31 |
| sp|Q8DEE1|LEU1_VIBVU | 2-isopropylmalate synthase OS=Vibrio vulnificus (strain CMCP6) GN=leuA PE=3 SV=1 | 47 | 376 | 3.0E-31 |
| sp|Q9EVG4|LEU1_BUCML | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuA PE=3 SV=1 | 54 | 408 | 5.0E-31 |
| sp|O04974|LEU1B_SOLPN | 2-isopropylmalate synthase B OS=Solanum pennellii GN=IPMSB PE=2 SV=1 | 11 | 404 | 7.0E-31 |
| sp|C5CYP2|LEU1_VARPS | 2-isopropylmalate synthase OS=Variovorax paradoxus (strain S110) GN=leuA PE=3 SV=1 | 47 | 404 | 7.0E-31 |
| sp|C5B7R4|LEU1_EDWI9 | 2-isopropylmalate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=leuA PE=3 SV=1 | 47 | 382 | 9.0E-31 |
| sp|Q9EVI8|LEU1_BUCUN | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuA PE=3 SV=1 | 54 | 403 | 1.0E-30 |
| sp|A2SHL8|LEU1_METPP | 2-isopropylmalate synthase OS=Methylibium petroleiphilum (strain PM1) GN=leuA PE=3 SV=1 | 44 | 408 | 2.0E-30 |
| sp|Q9RUA9|LEU1_DEIRA | 2-isopropylmalate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuA PE=3 SV=1 | 45 | 396 | 5.0E-30 |
| sp|Q00853|NIFVA_CLOPA | Homocitrate synthase subunit alpha OS=Clostridium pasteurianum GN=nifV-ALPHA PE=3 SV=1 | 47 | 269 | 7.0E-30 |
| sp|O86511|CIMA_STRCO | (R)-citramalate synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cimA PE=3 SV=1 | 45 | 424 | 1.0E-29 |
| sp|A5CWZ3|LEU1_VESOH | 2-isopropylmalate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=leuA PE=3 SV=1 | 44 | 404 | 1.0E-29 |
| sp|Q9EVH0|LEU1_BUCUM | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuA PE=3 SV=1 | 54 | 403 | 1.0E-29 |
| sp|E1QWZ1|LEU1_OLSUV | 2-isopropylmalate synthase OS=Olsenella uli (strain ATCC 49627 / DSM 7084 / CIP 109912 / JCM 12494 / VPI D76D-27C) GN=leuA PE=3 SV=1 | 44 | 410 | 8.0E-29 |
| sp|P70728|NIFV_AZOBR | Homocitrate synthase OS=Azospirillum brasilense GN=nifV PE=3 SV=1 | 47 | 377 | 3.0E-28 |
| sp|C7M0E4|LEU1_ACIFD | 2-isopropylmalate synthase OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=leuA PE=3 SV=1 | 37 | 406 | 5.0E-28 |
| sp|D5HB86|LEU1_SALRM | 2-isopropylmalate synthase OS=Salinibacter ruber (strain M8) GN=leuA PE=3 SV=1 | 47 | 434 | 6.0E-28 |
| sp|A1AWA1|LEU1_RUTMC | 2-isopropylmalate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuA PE=3 SV=1 | 44 | 396 | 2.0E-26 |
| sp|Q74C76|CIMA_GEOSL | (R)-citramalate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=cimA PE=1 SV=1 | 46 | 417 | 1.0E-24 |
| sp|P74269|CIMA_SYNY3 | (R)-citramalate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cimA PE=3 SV=1 | 47 | 379 | 2.0E-24 |
| sp|O31287|LEU1_BUCTS | 2-isopropylmalate synthase (Fragment) OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuA PE=3 SV=1 | 181 | 403 | 4.0E-20 |
| sp|Q56216|LEU1_THETH | 2-isopropylmalate synthase (Fragment) OS=Thermus thermophilus GN=leuA PE=2 SV=1 | 231 | 411 | 5.0E-17 |
| sp|C1B8I0|HOA2_RHOOB | 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus opacus (strain B4) GN=ROP_37360 PE=3 SV=1 | 44 | 269 | 8.0E-13 |
| sp|A1K6L9|HOA1_AZOSB | 4-hydroxy-2-oxovalerate aldolase 1 OS=Azoarcus sp. (strain BH72) GN=lapG PE=3 SV=1 | 40 | 273 | 9.0E-13 |
| sp|C1AVG2|HOA4_RHOOB | 4-hydroxy-2-oxovalerate aldolase 4 OS=Rhodococcus opacus (strain B4) GN=ROP_54050 PE=3 SV=1 | 44 | 269 | 1.0E-12 |
| sp|Q0S9W9|HOA2_RHOJR | 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus jostii (strain RHA1) GN=RHA1_ro03867 PE=3 SV=1 | 44 | 269 | 5.0E-12 |
| sp|B0VXM7|HOA_GEOSE | 4-hydroxy-2-oxovalerate aldolase OS=Geobacillus stearothermophilus GN=pheE PE=3 SV=1 | 47 | 346 | 1.0E-11 |
| sp|Q764S0|HOA_BACPJ | 4-hydroxy-2-oxovalerate aldolase OS=Bacillus sp. (strain JF8) GN=nahM PE=3 SV=2 | 45 | 280 | 3.0E-11 |
| sp|A0RD70|HOA_BACAH | 4-hydroxy-2-oxovalerate aldolase OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_1844 PE=3 SV=1 | 28 | 346 | 6.0E-11 |
| sp|C1ERL7|HOA_BACC3 | 4-hydroxy-2-oxovalerate aldolase OS=Bacillus cereus (strain 03BB102) GN=dmpG PE=3 SV=1 | 28 | 346 | 8.0E-11 |
| sp|O34873|HMGCL_BACSU | Hydroxymethylglutaryl-CoA lyase YngG OS=Bacillus subtilis (strain 168) GN=yngG PE=1 SV=1 | 44 | 265 | 1.0E-10 |
| sp|A4IT42|HOA_GEOTN | 4-hydroxy-2-oxovalerate aldolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=nbaI PE=3 SV=1 | 47 | 333 | 3.0E-10 |
| sp|Q5YV93|HOA2_NOCFA | 4-hydroxy-2-oxovalerate aldolase 2 OS=Nocardia farcinica (strain IFM 10152) GN=NFA_30510 PE=3 SV=1 | 47 | 269 | 2.0E-09 |
| sp|Q739I4|HOA_BACC1 | 4-hydroxy-2-oxovalerate aldolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2157 PE=3 SV=1 | 28 | 346 | 2.0E-09 |
| sp|Q3ACM0|HOA_CARHZ | 4-hydroxy-2-oxovalerate aldolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mhpE PE=3 SV=1 | 44 | 269 | 3.0E-09 |
| sp|Q479E5|HOA5_DECAR | 4-hydroxy-2-oxovalerate aldolase 5 OS=Dechloromonas aromatica (strain RCB) GN=Daro_3808 PE=3 SV=1 | 52 | 278 | 5.0E-09 |
| sp|Q31EF5|LEU12_THICR | 2-isopropylmalate synthase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=leuA2 PE=3 SV=1 | 52 | 335 | 8.0E-09 |
| sp|Q13WM0|LEU1_BURXL | 2-isopropylmalate synthase OS=Burkholderia xenovorans (strain LB400) GN=leuA PE=3 SV=1 | 48 | 353 | 2.0E-08 |
| sp|Q0VLR3|LEU1_ALCBS | 2-isopropylmalate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuA PE=3 SV=1 | 52 | 343 | 2.0E-08 |
| sp|Q2RT17|LEU1_RHORT | 2-isopropylmalate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuA PE=3 SV=1 | 25 | 351 | 2.0E-08 |
| sp|A6VSA9|LEU1_MARMS | 2-isopropylmalate synthase OS=Marinomonas sp. (strain MWYL1) GN=leuA PE=3 SV=1 | 52 | 353 | 2.0E-08 |
| sp|C1DN55|HOA3_AZOVD | 4-hydroxy-2-oxovalerate aldolase 3 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lapG PE=3 SV=1 | 52 | 273 | 2.0E-08 |
| sp|Q8XSZ5|LEU12_RALSO | 2-isopropylmalate synthase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=leuA2 PE=3 SV=1 | 25 | 353 | 5.0E-08 |
| sp|B2SXZ9|LEU1_BURPP | 2-isopropylmalate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=leuA PE=3 SV=1 | 48 | 353 | 6.0E-08 |
| sp|C0ZDU6|HOA_BREBN | 4-hydroxy-2-oxovalerate aldolase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=BBR47_29780 PE=3 SV=1 | 47 | 333 | 6.0E-08 |
| sp|Q8UD63|LEU1_AGRFC | 2-isopropylmalate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuA PE=3 SV=2 | 52 | 351 | 7.0E-08 |
| sp|Q7VH30|LEU1_HELHP | 2-isopropylmalate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuA PE=3 SV=1 | 52 | 351 | 7.0E-08 |
| sp|A2SL35|HOA2_METPP | 4-hydroxy-2-oxovalerate aldolase 2 OS=Methylibium petroleiphilum (strain PM1) GN=Mpe_A3321 PE=3 SV=1 | 52 | 333 | 1.0E-07 |
| sp|A7HP03|LEU1_PARL1 | 2-isopropylmalate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuA PE=3 SV=1 | 48 | 353 | 1.0E-07 |
| sp|E3PVH7|LEU1_CLOSD | 2-isopropylmalate synthase OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=leuA PE=3 SV=1 | 52 | 351 | 2.0E-07 |
| sp|Q2T7S9|HOA_BURTA | 4-hydroxy-2-oxovalerate aldolase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mhpE PE=3 SV=1 | 47 | 280 | 2.0E-07 |
| sp|A8M6W8|HOA2_SALAI | 4-hydroxy-2-oxovalerate aldolase 2 OS=Salinispora arenicola (strain CNS-205) GN=Sare_4567 PE=3 SV=1 | 44 | 319 | 2.0E-07 |
| sp|A5D523|HOA_PELTS | 4-hydroxy-2-oxovalerate aldolase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=PTH_0483 PE=3 SV=1 | 45 | 271 | 3.0E-07 |
| sp|Q63JB1|HOA_BURPS | 4-hydroxy-2-oxovalerate aldolase OS=Burkholderia pseudomallei (strain K96243) GN=mhpE PE=3 SV=1 | 47 | 280 | 5.0E-07 |
| sp|Q97MC5|LEU1_CLOAB | 2-isopropylmalate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuA PE=3 SV=1 | 52 | 335 | 6.0E-07 |
| sp|Q3JK55|HOA_BURP1 | 4-hydroxy-2-oxovalerate aldolase OS=Burkholderia pseudomallei (strain 1710b) GN=mhpE PE=3 SV=1 | 47 | 280 | 6.0E-07 |
| sp|A3NML2|HOA_BURP6 | 4-hydroxy-2-oxovalerate aldolase OS=Burkholderia pseudomallei (strain 668) GN=mhpE PE=3 SV=1 | 47 | 280 | 6.0E-07 |
| sp|A3P825|HOA_BURP0 | 4-hydroxy-2-oxovalerate aldolase OS=Burkholderia pseudomallei (strain 1106a) GN=BURPS1106A_A2454 PE=3 SV=1 | 47 | 280 | 6.0E-07 |
| sp|A8GG86|HOA_SERP5 | 4-hydroxy-2-oxovalerate aldolase OS=Serratia proteamaculans (strain 568) GN=mhpE PE=3 SV=1 | 47 | 273 | 7.0E-07 |
| sp|B9L2J0|HOA_THERP | 4-hydroxy-2-oxovalerate aldolase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trd_1392 PE=3 SV=1 | 46 | 272 | 9.0E-07 |
| sp|A0LBW3|LEU1_MAGMM | 2-isopropylmalate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuA PE=3 SV=1 | 23 | 335 | 9.0E-07 |
| sp|Q0A5T5|HOA_ALKEH | 4-hydroxy-2-oxovalerate aldolase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=Mlg_2462 PE=3 SV=1 | 51 | 273 | 1.0E-06 |
| sp|Q9ZI56|HOA_PSEST | 4-hydroxy-2-oxovalerate aldolase OS=Pseudomonas stutzeri GN=nahM PE=3 SV=1 | 194 | 336 | 1.0E-06 |
| sp|Q9X7L2|LEU1_RHIME | 2-isopropylmalate synthase OS=Rhizobium meliloti (strain 1021) GN=leuA PE=3 SV=3 | 52 | 351 | 1.0E-06 |
| sp|Q4K6V7|LEU1_PSEF5 | 2-isopropylmalate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuA PE=3 SV=1 | 50 | 335 | 1.0E-06 |
| sp|P51017|HOA1_PSEPU | 4-hydroxy-2-oxovalerate aldolase OS=Pseudomonas putida GN=nahM PE=3 SV=1 | 194 | 336 | 1.0E-06 |
| sp|B0TTS9|HOA_SHEHH | 4-hydroxy-2-oxovalerate aldolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=Shal_2088 PE=3 SV=1 | 187 | 318 | 4.0E-06 |
| sp|A6W1X1|HOA_MARMS | 4-hydroxy-2-oxovalerate aldolase OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_3801 PE=3 SV=1 | 198 | 336 | 5.0E-06 |
| sp|Q48LY5|LEU1_PSE14 | 2-isopropylmalate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuA PE=3 SV=1 | 50 | 335 | 6.0E-06 |
| sp|Q29448|HMGCL_BOVIN | Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2 | 40 | 265 | 9.0E-06 |
| sp|B2UJY9|LEU1_RALPJ | 2-isopropylmalate synthase OS=Ralstonia pickettii (strain 12J) GN=leuA PE=3 SV=1 | 44 | 353 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003824 | catalytic activity | Yes |
| GO:0003674 | molecular_function | No |
| Orthofinder run ID | 4 |
| Orthogroup | 2119 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|3610 MCETDGPAAAANQNNGSAGAAQSRPNTRSNPYQPVGDHLSNLGRFKIIESTLREGEQFANAYFDTETKIKFAKAL DEFGVDYIELTSPAASEASRQDCIAICKLGLKAKILTHVRCDMRDAQMAVDTGVDGLDIVIGTSSFLREHSHGKD MAYITKTALEVIEFVKSKGLEVRFSSEDSFRSDLVDLLSLYSAVDKAGVNRVGIADTVGCASPRQVYDLVRTLRS VVSCDIETHFHNDTGCAIANAYCALEAGATHVDTSVLGIGERNGITPLGGLLARMVVTSPDYVKSKYKLHKIKEI EDMVAEAVEVNTPFNNPITGFCAFTHKAGIHAKAILNNPSTYEILNPEDFGLTRYVHFASRLTGWNAVKTRVGQL GLSMTDDQVKEVTSKIKAMADVRPIAIDDADSIIRSFHLTLQENGTPAPHGTNGVATNGISA* |
| Coding | >OphauG2|3610 ATGTGTGAAACAGACGGCCCCGCGGCTGCTGCCAATCAGAATAATGGCAGTGCAGGCGCTGCTCAGTCACGTCCC AATACCCGCTCAAATCCCTACCAGCCTGTAGGCGATCATCTCTCAAATCTCGGCCGCTTCAAGATTATCGAGTCG ACGCTACGAGAGGGAGAACAATTCGCCAATGCCTATTTCGATACCGAAACCAAGATTAAGTTCGCCAAGGCTCTC GATGAGTTTGGAGTCGATTATATCGAATTGACTTCTCCTGCAGCCTCTGAGGCGTCGCGCCAGGATTGTATCGCC ATTTGCAAGCTCGGCCTCAAGGCCAAGATCTTGACACATGTCCGTTGTGATATGCGCGATGCCCAAATGGCCGTA GACACAGGCGTTGATGGACTTGATATTGTCATCGGCACCTCGAGCTTTCTCCGCGAACATAGCCATGGCAAGGAC ATGGCTTACATCACCAAGACGGCCCTCGAGGTTATCGAATTCGTCAAGTCCAAGGGGCTTGAAGTCCGATTCTCC AGCGAAGACTCCTTCCGGTCCGATCTTGTCGACCTGCTGTCACTTTATAGCGCCGTCGACAAGGCTGGTGTCAAC CGTGTAGGCATTGCTGACACTGTCGGCTGTGCATCTCCTCGCCAAGTCTATGATCTCGTGCGGACATTGAGAAGT GTTGTTTCATGCGATATTGAAACGCATTTTCACAATGACACGGGTTGTGCAATTGCAAATGCCTACTGTGCTCTC GAAGCTGGTGCGACCCATGTTGACACAAGCGTACTAGGCATTGGCGAGCGCAATGGCATTACTCCTCTGGGTGGA CTCTTGGCGCGCATGGTTGTCACGAGTCCTGATTATGTCAAGAGCAAGTATAAGCTGCACAAGATCAAGGAGATT GAAGACATGGTCGCTGAGGCTGTGGAGGTCAACACTCCTTTCAACAACCCCATTACAGGCTTTTGCGCCTTTACC CACAAGGCCGGTATTCACGCCAAGGCTATCCTCAACAACCCCTCGACCTATGAGATTCTCAACCCCGAGGACTTT GGCCTAACTCGCTATGTCCACTTTGCTTCACGTCTAACAGGGTGGAACGCTGTCAAGACACGTGTGGGACAGCTG GGTCTTAGCATGACAGATGATCAAGTCAAGGAGGTAACATCCAAGATCAAGGCTATGGCAGATGTGCGTCCGATT GCCATTGATGATGCCGACTCCATCATCCGCAGTTTCCACCTGACGCTTCAGGAAAATGGAACACCGGCACCTCAT GGGACTAATGGCGTGGCAACCAACGGTATTAGCGCTTAA |
| Transcript | >OphauG2|3610 ATGTGTGAAACAGACGGCCCCGCGGCTGCTGCCAATCAGAATAATGGCAGTGCAGGCGCTGCTCAGTCACGTCCC AATACCCGCTCAAATCCCTACCAGCCTGTAGGCGATCATCTCTCAAATCTCGGCCGCTTCAAGATTATCGAGTCG ACGCTACGAGAGGGAGAACAATTCGCCAATGCCTATTTCGATACCGAAACCAAGATTAAGTTCGCCAAGGCTCTC GATGAGTTTGGAGTCGATTATATCGAATTGACTTCTCCTGCAGCCTCTGAGGCGTCGCGCCAGGATTGTATCGCC ATTTGCAAGCTCGGCCTCAAGGCCAAGATCTTGACACATGTCCGTTGTGATATGCGCGATGCCCAAATGGCCGTA GACACAGGCGTTGATGGACTTGATATTGTCATCGGCACCTCGAGCTTTCTCCGCGAACATAGCCATGGCAAGGAC ATGGCTTACATCACCAAGACGGCCCTCGAGGTTATCGAATTCGTCAAGTCCAAGGGGCTTGAAGTCCGATTCTCC AGCGAAGACTCCTTCCGGTCCGATCTTGTCGACCTGCTGTCACTTTATAGCGCCGTCGACAAGGCTGGTGTCAAC CGTGTAGGCATTGCTGACACTGTCGGCTGTGCATCTCCTCGCCAAGTCTATGATCTCGTGCGGACATTGAGAAGT GTTGTTTCATGCGATATTGAAACGCATTTTCACAATGACACGGGTTGTGCAATTGCAAATGCCTACTGTGCTCTC GAAGCTGGTGCGACCCATGTTGACACAAGCGTACTAGGCATTGGCGAGCGCAATGGCATTACTCCTCTGGGTGGA CTCTTGGCGCGCATGGTTGTCACGAGTCCTGATTATGTCAAGAGCAAGTATAAGCTGCACAAGATCAAGGAGATT GAAGACATGGTCGCTGAGGCTGTGGAGGTCAACACTCCTTTCAACAACCCCATTACAGGCTTTTGCGCCTTTACC CACAAGGCCGGTATTCACGCCAAGGCTATCCTCAACAACCCCTCGACCTATGAGATTCTCAACCCCGAGGACTTT GGCCTAACTCGCTATGTCCACTTTGCTTCACGTCTAACAGGGTGGAACGCTGTCAAGACACGTGTGGGACAGCTG GGTCTTAGCATGACAGATGATCAAGTCAAGGAGGTAACATCCAAGATCAAGGCTATGGCAGATGTGCGTCCGATT GCCATTGATGATGCCGACTCCATCATCCGCAGTTTCCACCTGACGCTTCAGGAAAATGGAACACCGGCACCTCAT GGGACTAATGGCGTGGCAACCAACGGTATTAGCGCTTAA |
| Gene | >OphauG2|3610 ATGTGTGAAACAGACGGCCCCGCGGCTGCTGCCAATGTGTGTCACTGTTGATGCTGCTTTTTTCCGCCTTTCCCC CTCGCTGCCTCTCGTTATGGCGCTGACCCTGAGCTGCAATCCGCCCTCGTTTCCCCCAGCAGAATAATGGCAGTG CAGGCGCTGCTCAGTCACGTCCCAATACCCGCTCAAATCCCTACCAGCCTGTAGGCGATCATCTCTCAAATCTCG GCCGCTTCAAGATTATCGAGTCGACGCTACGAGGTCTGCCACCAGTTTCATCTGCCATTGTCTTCTCTCCCCCAA CGGCATTTGCTGACATGTGGCAAGAGGGAGAACAATTCGCCAATGCCTATTTCGATACCGAAACCAAGATTAAGT TGTGAGTATTGTATTCAAAATCGCAACAGCAGCCCGCCCAGTGCTAATTCAAACTTCAAACAGCGCCAAGGGTAC TACTTTCCCAGATGCCGCCCGCCTCCTCTGGCCCCTCCTCCCAACGTACCTCTACTGATTTTTTGTGCAGCTCTC GATGAGTTTGGAGTCGATTATATCGAATTGACTTCTCCTGCAGCCTCTGAGGCGTCGCGCCAGGATTGTATCGCC ATTTGCAAGCTCGGCCTCAAGGTATTGTACCGTCAATTCAACCCCGCACTCACGCCCGCTGACTTGTCCATGGTT AGGCCAAGATCTTGACACGTTAGTTGCATGCCATCTGATATTTACGCACTCGATGCTCAACTGCTCTTTAGATGT CCGTTGTGATATGCGCGATGCCCAAATGGCCGTAGACACAGGCGTTGATGGACTTGATATTGTCATCGGCACCTC GAGCTTTCTCCGCGAACATAGCCATGGCAAGGACATGGCTTACATCACCAAGACGGCCCTCGAGGTTATCGAATT CGTCAAGTCCAAGGGGCTTGAAGTCCGATGTAGGTTGGCCTAAGTGTCGCGTTACACAGAGACTCTGTACTGACC AAAACAGTCTCCAGCGAAGACTCCTTCCGGTCCGATCTTGTCGACCTGCTGTCACTTTATAGCGCCGTCGACAAG GCTGGTGTCAACCGTGTAGGCATTGCTGACACTGTCGGCTGTGCATCTCCTCGCCAAGTCTATGATGTATGTGTC ATGGCTCTTAGTGGCCTCTGTTTCTCGACTGACCTCTGTACCATTAGCTCGTGCGGACATTGAGAAGTGTTGTTT GTACGACTTTACCACGAGACTTTGTCCTCCATCAGATCTTTGATTGCTGACCTGAAACAGCATGCGATATTGAAA CGCATTTTCACAATGACACGGGTTGTGCAATTGCAAATGCGTAAGTTTGAAAAGTGACAGTTGAATCGTCTTGAA GGCTCACTGACGTGCCGCAGCTACTGTGCTCTCGAAGCTGGTGCGACCCATGTTGACACAAGCGTACTAGGCAGT CAGTATAGCACTAGCTTGCAAAGGGGAAACACTTGATGATGCTGACAGCGTCACCCACAGTTGGCGAGCGCAATG GCATTACTCCTCTGGGTGGACTCTTGGCGCGCATGGTTGTCACGAGTCCTGATTATGTCAAGAGCAAGTATAAGC TGCACAAGATCAAGGAGGTACGAAGTTTGTACAATGTCCTACGGACTATCACACGACTAACTATGTTGCTCAGAT TGAAGACATGGTCGCTGAGGCTGTGGAGGTAAGTTGTTTGAAAAGTCTATCCATCTCTTGACTTGAGGCGCACCT GTTTGTACGTGTTTGCATCAAGCTGACGGATTGCGCTAGGTCAACACTCCTTTCAACAACCCCATTACAGGCTTT TGCGCCTTTACCCACAAGGCCGGTATTCACGCCAAGGCTATCCTCAACAACCCCTCGACCTATGAGATTCTCAAC CCCGAGGACTTTGGCCTAACTCGCTATGTCCACTTTGCTTCACGTCTAACAGGGTGGAACGCTGTCAAGACACGT GTGGGACAGCTGGGTCTTAGCATGACAGATGATCAAGTCAAGGAGGTGTAAGTTGAGCCTCCAGACGCGCAACTA GAGCCGCCTCAGGCTGACGGAAGACTATTGCAGAACATCCAAGATCAAGGCTATGGCAGATGTGCGTCCGATTGC CATTGATGATGCCGACTCCATCATCCGCAGTTTCCACCTGACGCTTCAGGAAAATGGAACACCGGCACCTCATGG GACTAATGGCGTGGCAACCAACGGTATTAGCGCTTAA |