Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3608
Gene name
LocationContig_279:10626..12537
Strand-
Gene length (bp)1911
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12002 MgsA_C MgsA AAA+ ATPase C terminal 8.1E-58 469 628
PF16193 AAA_assoc_2 AAA C-terminal domain 2.6E-20 398 468
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.4E-11 258 365
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 1.1E-08 226 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13984|WRIP1_SCHPO ATPase WRNIP1 homolog C26H5.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.02c PE=3 SV=2 210 619 6.0E-148
sp|P40151|WRIP1_YEAST DNA-dependent ATPase MGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGS1 PE=1 SV=2 139 631 4.0E-115
sp|Q8CG07|WRIP1_RAT ATPase WRNIP1 OS=Rattus norvegicus GN=Wrnip1 PE=1 SV=1 215 621 2.0E-111
sp|Q91XU0|WRIP1_MOUSE ATPase WRNIP1 OS=Mus musculus GN=Wrnip1 PE=1 SV=2 215 621 5.0E-111
sp|Q96S55|WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2 215 621 8.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13984|WRIP1_SCHPO ATPase WRNIP1 homolog C26H5.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.02c PE=3 SV=2 210 619 6.0E-148
sp|P40151|WRIP1_YEAST DNA-dependent ATPase MGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGS1 PE=1 SV=2 139 631 4.0E-115
sp|Q8CG07|WRIP1_RAT ATPase WRNIP1 OS=Rattus norvegicus GN=Wrnip1 PE=1 SV=1 215 621 2.0E-111
sp|Q91XU0|WRIP1_MOUSE ATPase WRNIP1 OS=Mus musculus GN=Wrnip1 PE=1 SV=2 215 621 5.0E-111
sp|Q96S55|WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2 215 621 8.0E-111
sp|P39918|RARA_COXBU Replication-associated recombination protein A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rarA PE=3 SV=3 221 629 7.0E-99
sp|Q75JU2|WRIP1_DICDI ATPase WRNIP1 OS=Dictyostelium discoideum GN=wrnip1 PE=3 SV=1 220 619 3.0E-93
sp|P45262|RARA_HAEIN Replication-associated recombination protein A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rarA PE=3 SV=1 221 629 7.0E-93
sp|O34528|YRVN_BACSU Uncharacterized AAA domain-containing protein YrvN OS=Bacillus subtilis (strain 168) GN=yrvN PE=3 SV=1 221 624 1.0E-83
sp|P9WQN1|Y2559_MYCTU Uncharacterized AAA domain-containing protein Rv2559c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2559c PE=1 SV=1 220 613 4.0E-83
sp|P9WQN0|Y2559_MYCTO Uncharacterized AAA domain-containing protein MT2636 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2636 PE=3 SV=1 220 613 4.0E-83
sp|P0AAZ4|RARA_ECOLI Replication-associated recombination protein A OS=Escherichia coli (strain K12) GN=rarA PE=1 SV=1 221 626 9.0E-83
sp|P0AAZ5|RARA_ECOL6 Replication-associated recombination protein A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rarA PE=3 SV=1 221 626 9.0E-83
sp|P0AAZ6|RARA_ECO57 Replication-associated recombination protein A OS=Escherichia coli O157:H7 GN=rarA PE=3 SV=1 221 626 9.0E-83
sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0508 PE=3 SV=1 221 626 3.0E-81
sp|O74111|RFC3_BLAAD Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 215 490 8.0E-18
sp|O26343|RFCS_METTH Replication factor C small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcS PE=1 SV=1 219 427 8.0E-18
sp|Q2NH89|RFCS_METST Replication factor C small subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcS PE=3 SV=1 221 422 1.0E-16
sp|P38629|RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 218 523 1.0E-16
sp|Q99J62|RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 214 467 5.0E-15
sp|A5UMF3|RFCS_METS3 Replication factor C small subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcS PE=3 SV=1 219 424 3.0E-14
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 221 458 1.0E-13
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 221 458 2.0E-13
sp|P53033|RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 189 422 2.0E-13
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 209 422 3.0E-13
sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 214 467 3.0E-13
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 209 486 1.0E-12
sp|Q9CAQ8|RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 216 422 3.0E-12
sp|Q5UP47|RFCS3_MIMIV Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 213 442 5.0E-12
sp|Q6YZ54|RFC3_ORYSJ Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 218 422 8.0E-12
sp|Q5UZE5|RFCS_HALMA Replication factor C small subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcS PE=3 SV=2 224 424 1.0E-11
sp|Q54E21|RFC2_DICDI Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 221 422 2.0E-11
sp|Q3ITJ2|RFCS_NATPD Replication factor C small subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcS PE=3 SV=1 224 427 5.0E-11
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 224 428 6.0E-11
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 223 427 6.0E-11
sp|A4WGV2|RFCS1_PYRAR Replication factor C small subunit 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS1 PE=3 SV=1 224 426 8.0E-11
sp|P40348|RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC2 PE=1 SV=1 207 496 1.0E-10
sp|Q6L1I0|RFCS_PICTO Replication factor C small subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcS PE=3 SV=1 224 422 2.0E-10
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 224 426 3.0E-10
sp|O14003|RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 219 467 3.0E-10
sp|A6US36|RFCS_METVS Replication factor C small subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcS PE=3 SV=1 221 428 3.0E-10
sp|P40339|RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 221 426 3.0E-10
sp|A3CUX9|RFCS_METMJ Replication factor C small subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcS PE=3 SV=1 224 422 3.0E-10
sp|P53034|RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster GN=RfC4 PE=2 SV=1 221 422 4.0E-10
sp|A7I8Y0|RFCS_METB6 Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 224 428 7.0E-10
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 221 426 7.0E-10
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 224 426 1.0E-09
sp|Q54ST4|RFC5_DICDI Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 215 436 1.0E-09
sp|P74876|DPO3X_SALTY DNA polymerase III subunit tau OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaX PE=3 SV=2 222 443 1.0E-09
sp|Q9CAM7|RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 219 422 2.0E-09
sp|A0B6D7|RFCL_METTP Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 222 490 2.0E-09
sp|Q89A95|DPO3X_BUCBP DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaX PE=3 SV=1 222 427 6.0E-09
sp|P06710|DPO3X_ECOLI DNA polymerase III subunit tau OS=Escherichia coli (strain K12) GN=dnaX PE=1 SV=1 222 426 6.0E-09
sp|Q09843|RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc2 PE=1 SV=1 210 427 7.0E-09
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 221 422 9.0E-09
sp|P60374|RFCS_NANEQ Replication factor C small subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcS PE=3 SV=1 224 452 1.0E-08
sp|Q2FQT9|RFCS_METHJ Replication factor C small subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcS PE=3 SV=1 220 422 2.0E-08
sp|P34429|RFC5_CAEEL Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 219 422 2.0E-08
sp|A6VJ61|RFCS_METM7 Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 221 442 2.0E-08
sp|P43746|DPO3X_HAEIN DNA polymerase III subunit tau/gamma OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaX PE=3 SV=1 222 427 3.0E-08
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 224 426 4.0E-08
sp|Q9YBS5|RFCL_AERPE Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 212 465 6.0E-08
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 224 424 6.0E-08
sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaX PE=3 SV=1 222 422 7.0E-08
sp|B8H454|RUVB_CAUCN Holliday junction ATP-dependent DNA helicase RuvB OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ruvB PE=3 SV=1 223 354 7.0E-08
sp|Q9A3G8|RUVB_CAUCR Holliday junction ATP-dependent DNA helicase RuvB OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ruvB PE=3 SV=1 223 354 7.0E-08
sp|A3CTR4|RFCL_METMJ Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 222 421 8.0E-08
sp|Q9D0F6|RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus GN=Rfc5 PE=1 SV=1 210 422 1.0E-07
sp|A2SQT3|RFCS_METLZ Replication factor C small subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcS PE=3 SV=1 224 437 1.0E-07
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 221 422 2.0E-07
sp|Q2SZ55|RUVB_BURTA Holliday junction ATP-dependent DNA helicase RuvB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ruvB PE=3 SV=1 226 397 3.0E-07
sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1 210 422 3.0E-07
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 219 426 3.0E-07
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 223 422 3.0E-07
sp|Q8ZWS2|RFCS2_PYRAE Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 224 424 5.0E-07
sp|A4WLY0|RFCS2_PYRAR Replication factor C small subunit 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS2 PE=3 SV=1 224 424 6.0E-07
sp|C0R250|RUVB_BRAHW Holliday junction ATP-dependent DNA helicase RuvB OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ruvB PE=3 SV=1 224 355 6.0E-07
sp|Q977Z9|RFCS_THEVO Replication factor C small subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcS PE=3 SV=2 224 422 9.0E-07
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 223 422 1.0E-06
sp|Q9FXM3|RFC2_ORYSJ Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 217 442 1.0E-06
sp|Q11DH7|RUVB_CHESB Holliday junction ATP-dependent DNA helicase RuvB OS=Chelativorans sp. (strain BNC1) GN=ruvB PE=3 SV=1 226 368 2.0E-06
sp|A9AH73|RUVB_BURM1 Holliday junction ATP-dependent DNA helicase RuvB OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ruvB PE=3 SV=1 226 354 2.0E-06
sp|A1ARF8|RUVB_PELPD Holliday junction ATP-dependent DNA helicase RuvB OS=Pelobacter propionicus (strain DSM 2379) GN=ruvB PE=3 SV=1 226 368 2.0E-06
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 257 457 2.0E-06
sp|Q46C63|RFCS_METBF Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 218 424 3.0E-06
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 220 426 3.0E-06
sp|B9LZC4|RUVB_GEODF Holliday junction ATP-dependent DNA helicase RuvB OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ruvB PE=3 SV=1 226 371 3.0E-06
sp|A6SUQ4|RUVB_JANMA Holliday junction ATP-dependent DNA helicase RuvB OS=Janthinobacterium sp. (strain Marseille) GN=ruvB PE=3 SV=1 226 354 4.0E-06
sp|A4G1U9|RUVB_HERAR Holliday junction ATP-dependent DNA helicase RuvB OS=Herminiimonas arsenicoxydans GN=ruvB PE=3 SV=1 226 354 4.0E-06
sp|B0TSA7|RUVB_SHEHH Holliday junction ATP-dependent DNA helicase RuvB OS=Shewanella halifaxensis (strain HAW-EB4) GN=ruvB PE=3 SV=1 205 338 5.0E-06
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 219 433 6.0E-06
sp|C1D9W9|RUVB_LARHH Holliday junction ATP-dependent DNA helicase RuvB OS=Laribacter hongkongensis (strain HLHK9) GN=ruvB PE=3 SV=1 201 354 6.0E-06
sp|B2AH72|RUVB_CUPTR Holliday junction ATP-dependent DNA helicase RuvB OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ruvB PE=3 SV=1 226 397 6.0E-06
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 221 289 7.0E-06
sp|Q1LRB7|RUVB_CUPMC Holliday junction ATP-dependent DNA helicase RuvB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ruvB PE=3 SV=1 226 397 7.0E-06
sp|Q1GYS6|RUVB_METFK Holliday junction ATP-dependent DNA helicase RuvB OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ruvB PE=3 SV=1 205 453 7.0E-06
sp|A4J537|RUVB_DESRM Holliday junction ATP-dependent DNA helicase RuvB OS=Desulfotomaculum reducens (strain MI-1) GN=ruvB PE=3 SV=1 214 344 8.0E-06
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 223 424 8.0E-06
sp|Q0KEC4|RUVB_CUPNH Holliday junction ATP-dependent DNA helicase RuvB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ruvB PE=3 SV=1 226 354 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0006310 DNA recombination Yes
GO:0009378 four-way junction helicase activity Yes
GO:0006950 response to stress No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006259 DNA metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0140097 catalytic activity, acting on DNA No
GO:1901363 heterocyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0004386 helicase activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0003678 DNA helicase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0050896 response to stimulus No
GO:0016462 pyrophosphatase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3280
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3608 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6272
Ophiocordyceps camponoti-floridani Ophcf2|04339
Ophiocordyceps camponoti-rufipedis Ophun1|1516
Ophiocordyceps kimflemingae Ophio5|8023
Ophiocordyceps subramaniannii Hirsu2|60

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3608
MAVDCPICSKPVKTRDINSHIDSGCTSFIYDKEQQPSPPQSQAQAQPQFQAGQTGPRSTQKRPAADFFSVRAAKR
VQTNGNILLTPRPKSNGAGTKRSFDEGPGASAASQESEAGPETGATTKPGGQTAAAEAGGPGGQTTATEAGGPGG
QTTATEAGGPGGQPTAAAETGETKPAEEKGPGGQAAAAAAAAAAAQREPTTDSASDRVAKRPRTQQPKSAPLADR
MRPQKLDEVYGQDLVGPTGVLRALIESGRLPSMILWGASGTGKTTIARCMARAVAGRFVELNATSAGVHECKRIF
AQAATELALTGRKTVVFCDEMHRFSKAQQDVFLKPVEEGTVTLVAATTENPSFRLANALLSRCRVFTLEPLQTAH
VLDILRRAYALEQAAYPPAPALVDDDLLVYLAHFADGDARTALNLLELALALTLRDGITSQDDIKAALTKTFVYD
RCGDAHYDAISAFHKSVRGCDADAALYYLARMLQSGQDALFIARRMVVIASEDIGLADSSMLPLATAAYTAAQQI
GLPEARIPLAHCAVALSLAPKSTRVYRALNNAMDALREPGVAALPVPLHLRNAPTRLMRHLGCGADYKYPPNYRD
GRVKQSYLPQQLVGRRFLEDRDLGTEIDVDLAMPDA*
Coding >OphauG2|3608
ATGGCTGTCGACTGTCCCATCTGCAGCAAACCCGTCAAGACGAGAGACATTAACAGCCATATCGACTCGGGCTGC
ACCAGCTTCATCTACGACAAGGAGCAGCAGCCGTCGCCGCCACAGTCCCAGGCCCAGGCCCAGCCGCAGTTCCAA
GCTGGGCAGACGGGACCAAGGAGCACACAGAAACGCCCAGCGGCCGACTTCTTTTCTGTCCGGGCGGCGAAGCGG
GTGCAGACAAATGGCAACATTTTGCTGACGCCGCGGCCCAAGAGCAACGGCGCGGGGACCAAGAGGAGCTTTGAC
GAGGGGCCAGGGGCCAGTGCAGCGAGCCAAGAGTCTGAAGCAGGGCCAGAGACTGGAGCGACGACAAAGCCGGGA
GGGCAAACAGCAGCGGCAGAGGCGGGAGGGCCAGGAGGGCAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGG
CAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGACAACCAACAGCGGCGGCAGAGACTGGAGAGACAAAGCCG
GCAGAGGAGAAAGGGCCAGGAGGACAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACAAAGGGAGCCCACG
ACGGACAGTGCCAGTGACCGAGTGGCCAAGCGGCCCAGGACGCAGCAGCCGAAATCCGCACCGCTGGCAGACCGC
ATGCGCCCGCAAAAGCTGGACGAGGTGTATGGACAGGACCTGGTGGGCCCCACGGGCGTGCTCCGCGCGCTCATC
GAGTCGGGCCGCCTGCCGTCCATGATTCTCTGGGGCGCGTCGGGGACGGGCAAGACGACGATTGCGCGGTGCATG
GCGCGGGCGGTGGCGGGCCGCTTCGTCGAGCTGAATGCCACGAGCGCGGGAGTGCACGAGTGCAAGCGCATCTTT
GCCCAGGCGGCGACGGAGCTGGCGCTGACGGGCCGCAAGACGGTGGTGTTTTGCGACGAGATGCACCGCTTCTCC
AAGGCGCAGCAAGACGTCTTCCTCAAGCCCGTCGAGGAGGGCACCGTGACGCTCGTGGCCGCCACAACGGAGAAC
CCGTCGTTTCGCCTGGCCAACGCGCTGCTGTCGCGCTGTCGCGTCTTTACGCTGGAGCCGCTGCAGACGGCGCAC
GTGCTGGACATTTTGCGCCGCGCCTATGCCCTCGAACAGGCGGCCTATCCGCCGGCGCCGGCGCTGGTAGACGAC
GACTTGCTCGTCTATCTGGCGCACTTTGCCGATGGCGATGCCCGCACGGCGCTCAATCTGCTGGAGCTGGCGCTG
GCGCTGACGCTGCGTGACGGCATCACCAGCCAGGACGACATCAAGGCGGCCCTGACCAAGACCTTTGTCTACGAC
CGGTGCGGCGACGCGCACTACGACGCCATTTCCGCCTTTCACAAGTCGGTGCGCGGGTGCGATGCCGACGCGGCG
CTCTACTACCTGGCCCGCATGCTGCAGTCGGGCCAAGACGCCCTCTTTATTGCCCGCCGCATGGTGGTGATTGCC
TCGGAGGACATTGGCCTCGCCGACTCGTCCATGCTGCCGCTCGCCACGGCCGCCTATACCGCCGCCCAGCAGATT
GGCCTTCCCGAGGCCCGCATCCCCCTGGCCCACTGCGCCGTGGCCCTGAGCCTGGCTCCCAAGAGCACCCGCGTC
TACCGCGCCCTCAACAACGCAATGGACGCTCTGCGCGAGCCTGGCGTCGCCGCCCTGCCCGTCCCCCTGCACCTG
CGCAACGCCCCGACGCGTCTGATGCGCCATCTCGGCTGCGGCGCCGACTACAAGTATCCTCCAAACTACCGCGAC
GGCCGTGTCAAGCAGTCCTATCTGCCCCAGCAGCTCGTCGGCCGCCGCTTCCTCGAGGATAGGGACCTTGGCACC
GAGATTGATGTTGATCTCGCCATGCCCGATGCCTGA
Transcript >OphauG2|3608
ATGGCTGTCGACTGTCCCATCTGCAGCAAACCCGTCAAGACGAGAGACATTAACAGCCATATCGACTCGGGCTGC
ACCAGCTTCATCTACGACAAGGAGCAGCAGCCGTCGCCGCCACAGTCCCAGGCCCAGGCCCAGCCGCAGTTCCAA
GCTGGGCAGACGGGACCAAGGAGCACACAGAAACGCCCAGCGGCCGACTTCTTTTCTGTCCGGGCGGCGAAGCGG
GTGCAGACAAATGGCAACATTTTGCTGACGCCGCGGCCCAAGAGCAACGGCGCGGGGACCAAGAGGAGCTTTGAC
GAGGGGCCAGGGGCCAGTGCAGCGAGCCAAGAGTCTGAAGCAGGGCCAGAGACTGGAGCGACGACAAAGCCGGGA
GGGCAAACAGCAGCGGCAGAGGCGGGAGGGCCAGGAGGGCAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGG
CAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGACAACCAACAGCGGCGGCAGAGACTGGAGAGACAAAGCCG
GCAGAGGAGAAAGGGCCAGGAGGACAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACAAAGGGAGCCCACG
ACGGACAGTGCCAGTGACCGAGTGGCCAAGCGGCCCAGGACGCAGCAGCCGAAATCCGCACCGCTGGCAGACCGC
ATGCGCCCGCAAAAGCTGGACGAGGTGTATGGACAGGACCTGGTGGGCCCCACGGGCGTGCTCCGCGCGCTCATC
GAGTCGGGCCGCCTGCCGTCCATGATTCTCTGGGGCGCGTCGGGGACGGGCAAGACGACGATTGCGCGGTGCATG
GCGCGGGCGGTGGCGGGCCGCTTCGTCGAGCTGAATGCCACGAGCGCGGGAGTGCACGAGTGCAAGCGCATCTTT
GCCCAGGCGGCGACGGAGCTGGCGCTGACGGGCCGCAAGACGGTGGTGTTTTGCGACGAGATGCACCGCTTCTCC
AAGGCGCAGCAAGACGTCTTCCTCAAGCCCGTCGAGGAGGGCACCGTGACGCTCGTGGCCGCCACAACGGAGAAC
CCGTCGTTTCGCCTGGCCAACGCGCTGCTGTCGCGCTGTCGCGTCTTTACGCTGGAGCCGCTGCAGACGGCGCAC
GTGCTGGACATTTTGCGCCGCGCCTATGCCCTCGAACAGGCGGCCTATCCGCCGGCGCCGGCGCTGGTAGACGAC
GACTTGCTCGTCTATCTGGCGCACTTTGCCGATGGCGATGCCCGCACGGCGCTCAATCTGCTGGAGCTGGCGCTG
GCGCTGACGCTGCGTGACGGCATCACCAGCCAGGACGACATCAAGGCGGCCCTGACCAAGACCTTTGTCTACGAC
CGGTGCGGCGACGCGCACTACGACGCCATTTCCGCCTTTCACAAGTCGGTGCGCGGGTGCGATGCCGACGCGGCG
CTCTACTACCTGGCCCGCATGCTGCAGTCGGGCCAAGACGCCCTCTTTATTGCCCGCCGCATGGTGGTGATTGCC
TCGGAGGACATTGGCCTCGCCGACTCGTCCATGCTGCCGCTCGCCACGGCCGCCTATACCGCCGCCCAGCAGATT
GGCCTTCCCGAGGCCCGCATCCCCCTGGCCCACTGCGCCGTGGCCCTGAGCCTGGCTCCCAAGAGCACCCGCGTC
TACCGCGCCCTCAACAACGCAATGGACGCTCTGCGCGAGCCTGGCGTCGCCGCCCTGCCCGTCCCCCTGCACCTG
CGCAACGCCCCGACGCGTCTGATGCGCCATCTCGGCTGCGGCGCCGACTACAAGTATCCTCCAAACTACCGCGAC
GGCCGTGTCAAGCAGTCCTATCTGCCCCAGCAGCTCGTCGGCCGCCGCTTCCTCGAGGATAGGGACCTTGGCACC
GAGATTGATGTTGATCTCGCCATGCCCGATGCCTGA
Gene >OphauG2|3608
ATGGCTGTCGACTGTCCCATCTGCAGCAAACCCGTCAAGACGAGAGACATTAACAGCCATATCGACTCGGGCTGC
ACCAGCTTCATCTACGACAAGGAGCAGCAGCCGTCGCCGCCACAGTCCCAGGCCCAGGCCCAGCCGCAGTTCCAA
GCTGGGCAGACGGGACCAAGGAGCACACAGAAACGCCCAGCGGCCGACTTCTTTTCTGTCCGGGCGGCGAAGCGG
GTGCAGACAAATGGCAACATTTTGCTGACGCCGCGGCCCAAGAGCAACGGCGCGGGGACCAAGAGGAGCTTTGAC
GAGGGGCCAGGGGCCAGTGCAGCGAGCCAAGAGTCTGAAGCAGGGCCAGAGACTGGAGCGACGACAAAGCCGGGA
GGGCAAACAGCAGCGGCAGAGGCGGGAGGGCCAGGAGGGCAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGG
CAAACAACAGCGACAGAGGCGGGAGGGCCAGGCGGACAACCAACAGCGGCGGCAGAGACTGGAGAGACAAAGCCG
GCAGAGGAGAAAGGGCCAGGAGGACAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACAAAGGGAGCCCACG
ACGGACAGTGCCAGTGACCGAGTGGCCAAGCGGCCCAGGACGCAGCAGCCGAAATCCGCACCGCTGGCAGACCGC
ATGCGCCCGCAAAAGCTGGACGAGGTGTATGGACAGGACCTGGTGGGCCCCACGGGCGTGCTCCGCGCGCTCATC
GAGTCGGGCCGCCTGCCGTCCATGATTCTCTGGGGCGCGTCGGGGACGGGCAAGACGACGATTGCGCGGTGCATG
GCGCGGGCGGTGGCGGGCCGCTTCGTCGAGCTGAATGCCACGAGCGCGGGAGTGCACGAGTGCAAGCGCATCTTT
GCCCAGGCGGCGACGGAGCTGGCGCTGACGGGCCGCAAGACGGTGGTGTTTTGCGACGAGATGCACCGCTTCTCC
AAGGCGCAGCAAGACGTCTTCCTCAAGCCCGTCGAGGAGGGCACCGTGACGCTCGTGGCCGCCACAACGGAGAAC
CCGTCGTTTCGCCTGGCCAACGCGCTGCTGTCGCGCTGTCGCGTCTTTACGCTGGAGCCGCTGCAGACGGCGCAC
GTGCTGGACATTTTGCGCCGCGCCTATGCCCTCGAACAGGCGGCCTATCCGCCGGCGCCGGCGCTGGTAGACGAC
GACTTGCTCGTCTATCTGGCGCACTTTGCCGATGGCGATGCCCGCACGGCGCTCAATCTGCTGGAGCTGGCGCTG
GCGCTGACGCTGCGTGACGGCATCACCAGCCAGGACGACATCAAGGCGGCCCTGACCAAGACCTTTGTCTACGAC
CGGTGCGGCGACGCGCACTACGACGCCATTTCCGCCTTTCACAAGTCGGTGCGCGGGTGCGATGCCGACGCGGCG
CTCTACTACCTGGCCCGCATGCTGCAGTCGGGCCAAGACGCCCTCTTTATTGCCCGCCGCATGGTGGTGATTGCC
TCGGAGGACATTGGCCTCGCCGACTCGTCCATGCTGCCGCTCGCCACGGCCGCCTATACCGCCGCCCAGCAGATT
GGCCTTCCCGAGGCCCGCATCCCCCTGGCCCACTGCGCCGTGGCCCTGAGCCTGGCTCCCAAGAGCACCCGCGTC
TACCGCGCCCTCAACAACGCAATGGACGCTCTGCGCGAGCCTGGCGTCGCCGCCCTGCCCGTCCCCCTGCACCTG
CGCAACGCCCCGACGCGTCTGATGCGCCATCTCGGCTGCGGCGCCGACTACAAGTATCCTCCAAACTACCGCGAC
GGCCGTGTCAAGCAGTCCTATCTGCCCCAGCAGCTCGTCGGCCGCCGCTTCCTCGAGGATAGGGACCTTGGCACC
GAGATTGATGTTGATCTCGCCATGCCCGATGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail