Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3602
Gene name
LocationContig_278:10165..12137
Strand-
Gene length (bp)1972
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11786 Aft1_HRA Aft1 HRA domain 1.4E-24 130 200
PF11787 Aft1_HRR Aft1 HRR domain 2.1E-21 207 306
PF11785 Aft1_OSA Aft1 osmotic stress response (OSM) domain 1.1E-20 52 107
PF00170 bZIP_1 bZIP transcription factor 9.5E-13 435 494
PF07716 bZIP_2 Basic region leucine zipper 2.5E-05 444 488

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 86 506 2.0E-34
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 425 508 6.0E-21
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 425 508 6.0E-21
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 436 513 7.0E-21
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 436 513 8.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 86 506 2.0E-34
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 425 508 6.0E-21
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 425 508 6.0E-21
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 436 513 7.0E-21
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 436 513 8.0E-21
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 425 508 9.0E-21
sp|O93602|ATF2_CHICK Cyclic AMP-dependent transcription factor ATF-2 OS=Gallus gallus GN=ATF2 PE=2 SV=1 427 513 1.0E-20
sp|P15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens GN=ATF2 PE=1 SV=4 436 513 1.0E-20
sp|Q8K1L0|CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus GN=Creb5 PE=2 SV=3 427 508 3.0E-19
sp|Q02930|CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens GN=CREB5 PE=1 SV=3 427 508 1.0E-18
sp|P78962|ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf21 PE=3 SV=1 438 502 8.0E-16
sp|Q09771|ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf31 PE=3 SV=1 445 506 3.0E-14
sp|Q59VR1|SKO1_CANAL Transcriptional regulator SKO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKO1 PE=1 SV=1 433 493 3.0E-11
sp|Q09926|PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcr1 PE=1 SV=1 430 517 4.0E-08
sp|Q02100|SKO1_YEAST CRE-binding bZIP protein SKO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKO1 PE=1 SV=1 435 485 5.0E-08
sp|P09450|JUNB_MOUSE Transcription factor jun-B OS=Mus musculus GN=Junb PE=1 SV=1 429 499 6.0E-08
sp|P24898|JUNB_RAT Transcription factor jun-B OS=Rattus norvegicus GN=Junb PE=1 SV=2 429 499 6.0E-08
sp|Q0VBZ5|JUNB_BOVIN Transcription factor jun-B OS=Bos taurus GN=JUNB PE=2 SV=1 429 499 5.0E-07
sp|P17275|JUNB_HUMAN Transcription factor jun-B OS=Homo sapiens GN=JUNB PE=1 SV=1 429 499 9.0E-07
sp|P17535|JUND_HUMAN Transcription factor jun-D OS=Homo sapiens GN=JUND PE=1 SV=3 445 499 1.0E-06
sp|P52909|JUND_RAT Transcription factor jun-D OS=Rattus norvegicus GN=Jund PE=1 SV=1 445 499 1.0E-06
sp|P15066|JUND_MOUSE Transcription factor jun-D OS=Mus musculus GN=Jund PE=1 SV=1 445 499 1.0E-06
sp|P18870|JUN_CHICK Transcription factor AP-1 OS=Gallus gallus GN=JUN PE=1 SV=2 432 510 1.0E-06
sp|P54864|JUN_SERCA Transcription factor AP-1 OS=Serinus canaria GN=JUN PE=2 SV=1 432 510 2.0E-06
sp|P56432|JUN_PIG Transcription factor AP-1 OS=Sus scrofa GN=JUN PE=2 SV=1 432 510 2.0E-06
sp|O77627|JUN_BOVIN Transcription factor AP-1 OS=Bos taurus GN=JUN PE=2 SV=2 432 510 2.0E-06
sp|P17325|JUN_RAT Transcription factor AP-1 OS=Rattus norvegicus GN=Jun PE=1 SV=1 432 510 2.0E-06
sp|P05627|JUN_MOUSE Transcription factor AP-1 OS=Mus musculus GN=Jun PE=1 SV=3 432 510 2.0E-06
sp|P05412|JUN_HUMAN Transcription factor AP-1 OS=Homo sapiens GN=JUN PE=1 SV=2 432 510 2.0E-06
sp|A7YY54|JUND_BOVIN Transcription factor jun-D OS=Bos taurus GN=JUND PE=2 SV=1 445 499 2.0E-06
sp|P27921|JUND_CHICK Transcription factor jun-D OS=Gallus gallus GN=JUND PE=3 SV=1 432 499 2.0E-06
sp|P12981|JUN_COTJA Transcription factor AP-1 OS=Coturnix coturnix japonica GN=JUN PE=2 SV=1 432 510 2.0E-06
sp|P18289|JRA_DROME Transcription factor AP-1 OS=Drosophila melanogaster GN=Jra PE=1 SV=2 401 499 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1718
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3602 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5275
Ophiocordyceps camponoti-floridani Ophcf2|02089
Ophiocordyceps camponoti-rufipedis Ophun1|2222
Ophiocordyceps kimflemingae Ophio5|4599
Ophiocordyceps subramaniannii Hirsu2|1546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3602
MGSAPTNASSARGYSKSPKQTNNRPSPGPDAASASAPDSKPDVGATAESSSTTEAAKPLAPPPRPNQSQQQQQGA
NTPDYFAPHGGSLSLEPNPFEQSFGGGGPETPGGTKLPSVAALTSPSSLLPGSNATPFNWGGGSLRTGPLSPAML
SGPANDYFADTHHLRGGFPTPNESSLRTGLTPGGSGSMFPAPSPNSQAIFAQIASGGATPGTLDFHRTALSAAVK
REQTNGVAQSTQQAPTQPQSQAQSQQVPQPQTQQPQQQSATSSTQDMPALTSKAEPKSAHGPFDPHDNDAANGLF
MLAQGRNGSQSMGHYSSTSTAGHAHPASAASQNADMSPQLSSGNAGSIGSGRGVSEASNISDDAEPSRATNKGRS
RKNTSTSNGRRKADEPLQKPSANKKTKSNNTDGYDMSDDEDSKLGLDEGSNGGPKTKMTEEDKRRNFLERNRVAA
LKCRQRKKQWLANLQNKVELFSSENDQLTTQITQLREEVVNLKTLLLAHKDCPVTQQQGLHGAFMSQVVEPYNAQ
MNPYGMAGTMSNQQVMAGQGVQRRYS*
Coding >OphauG2|3602
ATGGGCTCTGCTCCCACAAACGCCTCTTCTGCACGAGGCTACTCTAAGTCGCCAAAACAAACAAACAATAGACCG
TCTCCAGGTCCCGACGCTGCCTCCGCCTCGGCGCCCGACTCCAAGCCCGACGTCGGTGCGACGGCCGAAAGCTCG
TCGACCACGGAAGCTGCGAAACCCTTGGCGCCGCCTCCAAGACCGAATCAGAGTCAACAGCAGCAACAAGGCGCA
AACACACCAGACTATTTCGCACCTCACGGAGGATCTCTCAGCTTGGAGCCCAACCCCTTCGAGCAATCCTTTGGC
GGTGGCGGGCCCGAGACACCAGGAGGGACTAAGCTTCCCTCTGTTGCTGCCTTGACATCGCCATCTTCTCTGCTA
CCAGGCAGCAACGCCACACCCTTTAATTGGGGGGGAGGATCACTGCGAACTGGACCTTTGAGCCCAGCCATGTTG
TCGGGTCCTGCCAACGATTACTTTGCCGATACCCACCATCTGCGTGGCGGCTTCCCCACCCCAAACGAGTCTTCA
CTGAGGACTGGACTGACACCTGGAGGCAGTGGATCCATGTTTCCCGCCCCAAGTCCTAATTCTCAAGCCATATTT
GCGCAAATAGCCAGCGGAGGCGCCACCCCGGGCACCCTTGATTTCCATCGCACCGCCCTTAGCGCTGCCGTTAAG
CGCGAGCAGACAAACGGCGTCGCACAGTCCACCCAGCAAGCTCCAACCCAGCCACAATCTCAAGCTCAGTCTCAG
CAAGTCCCTCAACCACAGACACAACAGCCCCAGCAGCAGTCAGCCACCTCCAGCACACAGGACATGCCAGCACTT
ACATCAAAAGCGGAGCCTAAGTCTGCTCACGGGCCGTTTGACCCGCATGATAACGACGCCGCCAATGGTCTCTTT
ATGCTCGCTCAAGGCCGCAACGGATCTCAGAGTATGGGCCATTACTCGTCTACTTCTACTGCAGGACACGCGCAT
CCTGCTTCTGCCGCTTCGCAAAATGCGGACATGTCACCTCAGCTCTCAAGTGGTAATGCTGGATCAATTGGCTCT
GGGCGAGGCGTAAGTGAAGCGAGTAATATTTCAGACGACGCTGAGCCATCAAGAGCTACCAACAAAGGACGGAGT
AGGAAGAACACGTCTACATCTAACGGCCGGAGGAAAGCAGACGAACCCCTTCAGAAGCCTTCTGCGAACAAGAAG
ACCAAGTCCAACAATACTGACGGTTATGACATGTCTGATGATGAAGACAGCAAGCTTGGACTTGATGAAGGCTCT
AATGGAGGTCCAAAGACAAAAATGACTGAAGAAGACAAGCGGAGGAATTTTCTGGAAAGAAATCGCGTCGCTGCC
CTCAAATGTCGCCAACGCAAGAAACAGTGGCTTGCGAATCTGCAGAACAAGGTCGAATTGTTTAGCTCTGAGAAT
GATCAATTGACCACGCAAATCACACAACTTCGAGAGGAAGTCGTCAACCTCAAAACTTTACTATTGGCGCATAAA
GACTGCCCGGTAACACAGCAACAAGGTCTGCACGGAGCCTTCATGTCGCAGGTTGTTGAGCCCTACAACGCCCAG
ATGAACCCATATGGAATGGCCGGAACCATGTCGAATCAACAAGTAATGGCTGGCCAAGGAGTTCAACGTCGGTAC
TCTTGA
Transcript >OphauG2|3602
ATGGGCTCTGCTCCCACAAACGCCTCTTCTGCACGAGGCTACTCTAAGTCGCCAAAACAAACAAACAATAGACCG
TCTCCAGGTCCCGACGCTGCCTCCGCCTCGGCGCCCGACTCCAAGCCCGACGTCGGTGCGACGGCCGAAAGCTCG
TCGACCACGGAAGCTGCGAAACCCTTGGCGCCGCCTCCAAGACCGAATCAGAGTCAACAGCAGCAACAAGGCGCA
AACACACCAGACTATTTCGCACCTCACGGAGGATCTCTCAGCTTGGAGCCCAACCCCTTCGAGCAATCCTTTGGC
GGTGGCGGGCCCGAGACACCAGGAGGGACTAAGCTTCCCTCTGTTGCTGCCTTGACATCGCCATCTTCTCTGCTA
CCAGGCAGCAACGCCACACCCTTTAATTGGGGGGGAGGATCACTGCGAACTGGACCTTTGAGCCCAGCCATGTTG
TCGGGTCCTGCCAACGATTACTTTGCCGATACCCACCATCTGCGTGGCGGCTTCCCCACCCCAAACGAGTCTTCA
CTGAGGACTGGACTGACACCTGGAGGCAGTGGATCCATGTTTCCCGCCCCAAGTCCTAATTCTCAAGCCATATTT
GCGCAAATAGCCAGCGGAGGCGCCACCCCGGGCACCCTTGATTTCCATCGCACCGCCCTTAGCGCTGCCGTTAAG
CGCGAGCAGACAAACGGCGTCGCACAGTCCACCCAGCAAGCTCCAACCCAGCCACAATCTCAAGCTCAGTCTCAG
CAAGTCCCTCAACCACAGACACAACAGCCCCAGCAGCAGTCAGCCACCTCCAGCACACAGGACATGCCAGCACTT
ACATCAAAAGCGGAGCCTAAGTCTGCTCACGGGCCGTTTGACCCGCATGATAACGACGCCGCCAATGGTCTCTTT
ATGCTCGCTCAAGGCCGCAACGGATCTCAGAGTATGGGCCATTACTCGTCTACTTCTACTGCAGGACACGCGCAT
CCTGCTTCTGCCGCTTCGCAAAATGCGGACATGTCACCTCAGCTCTCAAGTGGTAATGCTGGATCAATTGGCTCT
GGGCGAGGCGTAAGTGAAGCGAGTAATATTTCAGACGACGCTGAGCCATCAAGAGCTACCAACAAAGGACGGAGT
AGGAAGAACACGTCTACATCTAACGGCCGGAGGAAAGCAGACGAACCCCTTCAGAAGCCTTCTGCGAACAAGAAG
ACCAAGTCCAACAATACTGACGGTTATGACATGTCTGATGATGAAGACAGCAAGCTTGGACTTGATGAAGGCTCT
AATGGAGGTCCAAAGACAAAAATGACTGAAGAAGACAAGCGGAGGAATTTTCTGGAAAGAAATCGCGTCGCTGCC
CTCAAATGTCGCCAACGCAAGAAACAGTGGCTTGCGAATCTGCAGAACAAGGTCGAATTGTTTAGCTCTGAGAAT
GATCAATTGACCACGCAAATCACACAACTTCGAGAGGAAGTCGTCAACCTCAAAACTTTACTATTGGCGCATAAA
GACTGCCCGGTAACACAGCAACAAGGTCTGCACGGAGCCTTCATGTCGCAGGTTGTTGAGCCCTACAACGCCCAG
ATGAACCCATATGGAATGGCCGGAACCATGTCGAATCAACAAGTAATGGCTGGCCAAGGAGTTCAACGTCGGTAC
TCTTGA
Gene >OphauG2|3602
ATGGGCTCTGCTCCCACAAACGCCTCTTCTGCACGAGGCTACTCTAAGTCGCCAAAACAAACAAACAATAGACCG
TCTCCAGGTCCCGGTGAGCAAAGTTTTTTTTCTTGATCCCACACACTCCTCCTGCCTGCAACATTCGCCCCTGCC
ACCTATATAATACTTTCCCCGCTTTCGTCATCAAAGTCCATCTGCTTGAACTACTCCTTGGCCCATGTGCATCAT
TTTCCCTCATGCTATTTTGGCTCGTCGTCATCGATAACTGCATCAAACTCTTCTGCCCCCCATCATCGTCGCGTC
ACAAAGCTGTCTATTGTGTGGTTGGCGGCACTGAGCTTACAGCTGCCATCAGACGCTGCCTCCGCCTCGGCGCCC
GACTCCAAGCCCGACGTCGGTGCGACGGCCGAAAGCTCGTCGACCACGGAAGCTGCGAAACCCTTGGCGCCGCCT
CCAAGACCGAATCAGAGTCAACAGCAGCAACAAGGCGCAAACACACCAGACTATTTCGCACCTCACGGAGGATCT
CTCAGCTTGGAGCCCAACCCCTTCGAGCAATCCTTTGGCGGTGGCGGGCCCGAGACACCAGGAGGGACTAAGCTT
CCCTCTGTTGCTGCCTTGACATCGCCATCTTCTCTGCTACCAGGCAGCAACGCCACACCCTTTAATTGGGGGGGA
GGATCACTGCGAACTGGACCTTTGAGCCCAGCCATGTTGTCGGGTCCTGCCAACGATTACTTTGCCGATACCCAC
CATCTGCGTGGCGGCTTCCCCACCCCAAACGAGTCTTCACTGAGGACTGGACTGACACCTGGAGGCAGTGGATCC
ATGTTTCCCGCCCCAAGTCCTAATTCTCAAGCCATATTTGCGCAAATAGCCAGCGGAGGCGCCACCCCGGGCACC
CTTGATTTCCATCGCACCGCCCTTAGCGCTGCCGTTAAGCGCGAGCAGACAAACGGCGTCGCACAGTCCACCCAG
CAAGCTCCAACCCAGCCACAATCTCAAGCTCAGTCTCAGCAAGTCCCTCAACCACAGACACAACAGCCCCAGCAG
CAGTCAGCCACCTCCAGCACACAGGACATGCCAGCACTTACATCAAAAGCGGAGCCTAAGTCTGCTCACGGGCCG
TTTGACCCGCATGATAACGACGCCGCCAATGGTCTCTTTATGCTCGCTCAAGGCCGCAACGGATCTCAGAGTATG
GGCCATTACTCGTCTACTTCTACTGCAGGACACGCGCATCCTGCTTCTGCCGCTTCGCAAAATGCGGACATGTCA
CCTCAGCTCTCAAGTGGTAATGCTGGATCAATTGGCTCTGGGCGAGGCGTAAGTGAAGCGAGTAATATTTCAGAC
GACGCTGAGCCATCAAGAGCTACCAACAAAGGACGGAGTAGGAAGAACACGTCTACATCTAACGGCCGGAGGAAA
GCAGACGAACCCCTTCAGAAGCCTTCTGCGAACAAGAAGACCAAGTCCAACAATACTGACGGTTATGACATGTCT
GATGATGAAGACAGCAAGCTTGGACTTGATGAAGGCTCTAATGGAGGTCCAAAGACAAAAATGACTGAAGAAGAC
AAGCGGAGGAATTTTCTGGAAAGAAATCGGTACGACGAATTGTCATTGATTTACGGTACATATCACTAACTATTT
TGTCAGCGTCGCTGCCCTCAAATGTCGCCAACGCAAGAAACAGTGGCTTGCGAATCTGCAGAACAAGGTCGAATT
GTTTAGCTCTGAGAATGATCAATTGACCACGCAAATCACACAACTTCGAGAGGAAGTCGTCAACCTCAAAACTTT
ACTATTGGCGCATAAAGACTGCCCGGTAACACAGCAACAAGGTCTGCACGGAGCCTTCATGTCGCAGGTTGTTGA
GCCCTACAACGCCCAGATGAACCCATATGGAATGGCCGGAACCATGTCGAATCAACAAGTAATGGCTGGCCAAGG
AGTTCAACGTCGGTACTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail