Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3600
Gene name
LocationContig_278:5480..6639
Strand+
Gene length (bp)1159
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03937 Sdh5 Flavinator of succinate dehydrogenase 8.7E-22 63 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NT06|SDHF2_ASPFN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_051990 PE=3 SV=1 35 214 6.0E-45
sp|Q0CSY3|SDHF2_ASPTN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03201 PE=3 SV=1 35 215 8.0E-44
sp|B6HRA4|SDHF2_PENRW Succinate dehydrogenase assembly factor 2, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g03150 PE=3 SV=1 35 199 2.0E-43
sp|B9W8P6|SDHF2_CANDC Succinate dehydrogenase assembly factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_08200 PE=3 SV=1 46 123 2.0E-23
sp|A3GHR8|SDHF2_PICST Succinate dehydrogenase assembly factor 2, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_53561 PE=3 SV=2 46 123 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NT06|SDHF2_ASPFN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_051990 PE=3 SV=1 35 214 6.0E-45
sp|Q0CSY3|SDHF2_ASPTN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03201 PE=3 SV=1 35 215 8.0E-44
sp|B6HRA4|SDHF2_PENRW Succinate dehydrogenase assembly factor 2, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g03150 PE=3 SV=1 35 199 2.0E-43
sp|B9W8P6|SDHF2_CANDC Succinate dehydrogenase assembly factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_08200 PE=3 SV=1 46 123 2.0E-23
sp|A3GHR8|SDHF2_PICST Succinate dehydrogenase assembly factor 2, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_53561 PE=3 SV=2 46 123 3.0E-22
sp|Q6BPG7|SDHF2_DEBHA Succinate dehydrogenase assembly factor 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2E13750g PE=3 SV=1 46 123 8.0E-22
sp|A5DT64|SDHF2_LODEL Succinate dehydrogenase assembly factor 2, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_00550 PE=3 SV=1 46 124 9.0E-22
sp|Q6C202|SDHF2_YARLI Succinate dehydrogenase assembly factor 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F11957g PE=3 SV=1 48 132 2.0E-21
sp|Q4PIM8|SDHF2_USTMA Succinate dehydrogenase assembly factor 2, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10010 PE=3 SV=2 15 117 2.0E-20
sp|A5DJ67|SDHF2_PICGU Succinate dehydrogenase assembly factor 2, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_03318 PE=3 SV=2 46 123 2.0E-20
sp|A6ZND9|SDHF2_YEAS7 Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=SDH5 PE=3 SV=1 48 123 1.0E-19
sp|B3LIY9|SDHF2_YEAS1 Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDH5 PE=3 SV=1 48 123 1.0E-19
sp|Q08230|SDHF2_YEAST Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH5 PE=1 SV=1 48 123 1.0E-19
sp|Q6CND9|SDHF2_KLULA Succinate dehydrogenase assembly factor 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E13333g PE=3 SV=1 46 123 1.0E-19
sp|Q6FQ93|SDHF2_CANGA Succinate dehydrogenase assembly factor 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0I08085g PE=3 SV=1 46 123 1.0E-18
sp|C4R0B5|SDHF2_PICPG Succinate dehydrogenase assembly factor 2, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr2-1_0323 PE=3 SV=1 45 123 1.0E-18
sp|Q756Q4|SDHF2_ASHGO Succinate dehydrogenase assembly factor 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AER200C PE=3 SV=1 48 123 3.0E-18
sp|B4LKE5|SDHF2_DROVI Succinate dehydrogenase assembly factor 2, mitochondrial OS=Drosophila virilis GN=GJ20144 PE=3 SV=1 17 123 2.0E-17
sp|B3MGU5|SDF2B_DROAN Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila ananassae GN=GF11203 PE=3 SV=1 21 116 2.0E-16
sp|P0CR32|SDHF2_CRYNJ Succinate dehydrogenase assembly factor 2, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04680 PE=3 SV=1 49 122 5.0E-16
sp|P0CR33|SDHF2_CRYNB Succinate dehydrogenase assembly factor 2, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBA4490 PE=3 SV=1 49 122 5.0E-16
sp|B4KN44|SDF2A_DROMO Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila mojavensis GN=GI20197 PE=3 SV=1 13 123 5.0E-16
sp|A3KP74|SDHF2_DANRE Succinate dehydrogenase assembly factor 2, mitochondrial OS=Danio rerio GN=sdhaf2 PE=2 SV=1 50 128 9.0E-16
sp|Q8C6I2|SDHF2_MOUSE Succinate dehydrogenase assembly factor 2, mitochondrial OS=Mus musculus GN=Sdhaf2 PE=1 SV=1 53 122 9.0E-16
sp|Q5RJQ7|SDHF2_RAT Succinate dehydrogenase assembly factor 2, mitochondrial OS=Rattus norvegicus GN=Sdhaf2 PE=2 SV=1 53 122 9.0E-16
sp|B6JZ70|SDHF2_SCHJY Succinate dehydrogenase assembly factor 2, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_01895 PE=3 SV=1 48 122 1.0E-15
sp|B4NXN5|SDF2B_DROYA Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila yakuba GN=GE21507 PE=3 SV=1 52 123 7.0E-15
sp|B4QID8|SDF2B_DROSI Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila simulans GN=GD25982 PE=3 SV=1 52 123 2.0E-14
sp|Q3ZBC2|SDHF2_BOVIN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Bos taurus GN=SDHAF2 PE=2 SV=1 53 122 2.0E-14
sp|Q9NX18|SDHF2_HUMAN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Homo sapiens GN=SDHAF2 PE=1 SV=1 53 122 3.0E-14
sp|Q4V5I9|SDF2A_DROME Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila melanogaster GN=CG14757 PE=2 SV=1 52 122 3.0E-14
sp|B4GDB3|SDF2A_DROPE Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila persimilis GN=GL10881 PE=3 SV=1 52 130 3.0E-14
sp|B4QFP7|SDF2A_DROSI Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila simulans GN=GD10178 PE=3 SV=1 52 122 3.0E-14
sp|B4HRL4|SDF2A_DROSE Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila sechellia GN=GM20711 PE=3 SV=1 52 122 3.0E-14
sp|Q5R4W7|SDHF2_PONAB Succinate dehydrogenase assembly factor 2, mitochondrial OS=Pongo abelii GN=SDHAF2 PE=2 SV=1 53 122 3.0E-14
sp|B4J5U3|SDHF2_DROGR Succinate dehydrogenase assembly factor 2, mitochondrial OS=Drosophila grimshawi GN=GH20828 PE=3 SV=1 53 123 3.0E-14
sp|B5DZ31|SDF2B_DROPS Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA24523 PE=3 SV=1 52 130 3.0E-14
sp|B4P2P8|SDF2A_DROYA Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila yakuba GN=GE23226 PE=3 SV=1 21 122 3.0E-14
sp|Q10440|SDHF2_SCHPO Succinate dehydrogenase assembly factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emi5 PE=3 SV=1 48 129 4.0E-14
sp|B0XK69|SDHF2_CULQU Succinate dehydrogenase assembly factor 2, mitochondrial OS=Culex quinquefasciatus GN=CPIJ019830 PE=3 SV=1 23 116 4.0E-14
sp|B1P1W2|SDHF2_ARTSF Succinate dehydrogenase assembly factor 2, mitochondrial OS=Artemia franciscana PE=2 SV=1 53 116 4.0E-14
sp|B4MRE7|SDF2A_DROWI Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila willistoni GN=GK15773 PE=3 SV=1 53 122 4.0E-14
sp|B3N6D9|SDF2B_DROER Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila erecta GN=GG25208 PE=3 SV=1 52 123 4.0E-14
sp|A1Z897|SDF2B_DROME Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila melanogaster GN=CG12895 PE=2 SV=1 52 123 5.0E-14
sp|B5E0U2|SDF2A_DROPS Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA25039 PE=3 SV=1 61 123 6.0E-14
sp|B4HMQ1|SDF2B_DROSE Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila sechellia GN=GM20523 PE=3 SV=1 52 123 6.0E-14
sp|B3MI37|SDF2A_DROAN Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila ananassae GN=GF11110 PE=3 SV=1 61 123 8.0E-14
sp|B4GG58|SDF2B_DROPE Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila persimilis GN=GL17204 PE=3 SV=1 52 123 8.0E-14
sp|B4N665|SDF2B_DROWI Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila willistoni GN=GK18008 PE=3 SV=1 61 122 2.0E-13
sp|B3N8S9|SDF2A_DROER Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila erecta GN=GG10665 PE=3 SV=1 21 116 3.0E-13
sp|Q178L7|SDHF2_AEDAE Succinate dehydrogenase assembly factor 2, mitochondrial OS=Aedes aegypti GN=AAEL005866 PE=3 SV=1 30 116 1.0E-12
sp|B4KPG8|SDF2B_DROMO Succinate dehydrogenase assembly factor 2-B, mitochondrial OS=Drosophila mojavensis GN=GI20928 PE=3 SV=1 61 122 2.0E-12
sp|Q9NA72|SDHF2_CAEEL Succinate dehydrogenase assembly factor 2, mitochondrial OS=Caenorhabditis elegans GN=Y57A10A.29 PE=3 SV=1 56 128 2.0E-09
sp|A8XYZ2|SDHF2_CAEBR Succinate dehydrogenase assembly factor 2, mitochondrial OS=Caenorhabditis briggsae GN=CBG20928 PE=3 SV=1 56 127 5.0E-09
sp|Q54B20|SDHF2_DICDI Succinate dehydrogenase assembly factor 2, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0293946 PE=3 SV=1 62 122 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3600
MALALRPAYRATRLLTSVPLRCLSSKTSGPPPTKDLDVGELEGALFHIKPLVRVHERSGVKRARLLYQSRKRGTL
EAELLFSTFASKYLANLPRAMLEEYDRLLDENDWDLYYWATQPDECPPPNPEAQNPAPAATPTSSSTKPKTTAPQ
DSFVRETPPVGEWAQTVGNIHRAYRPVPERWRNSHILRLLRAHVKNGSSGCNPGGLGSMPPLGVHHDAPHPDYDS
GDYYIRPQTSRDEIRDTAKHERKMKRIKFRKEQRALAREWALENINEDGTSKEVASSREKKRALNLLHREIRAQK
WAITNYKVGEPLPHTTNIYEANALKKLVHESKSLKNQEKQNQETTTSPS*
Coding >OphauG2|3600
ATGGCTTTGGCTCTACGTCCCGCATACCGCGCCACACGCCTCCTTACCTCGGTTCCTCTCAGATGCCTCAGCAGC
AAAACATCTGGCCCGCCACCGACCAAGGATCTCGACGTGGGCGAGCTTGAAGGTGCCTTGTTTCATATCAAGCCG
CTGGTGCGCGTGCACGAGCGGTCTGGTGTCAAACGCGCGCGTCTCCTCTATCAATCTCGCAAGCGCGGCACTCTG
GAAGCCGAGCTTTTATTCTCAACCTTTGCCTCCAAATATCTCGCCAATCTACCCCGTGCCATGCTCGAAGAATAT
GACCGACTACTCGACGAAAACGACTGGGACTTGTACTACTGGGCCACACAGCCCGATGAGTGTCCGCCGCCCAAC
CCCGAAGCCCAAAATCCAGCTCCTGCCGCCACCCCAACCTCTTCCAGCACTAAGCCGAAAACCACAGCCCCTCAA
GACTCCTTTGTACGCGAGACGCCTCCAGTGGGGGAATGGGCACAAACAGTCGGCAACATTCACCGGGCATATCGC
CCCGTGCCTGAACGCTGGCGTAACTCGCACATCTTGCGCCTCCTACGAGCCCACGTCAAGAATGGAAGCTCCGGC
TGCAATCCTGGGGGCTTGGGCTCTATGCCCCCTTTGGGGGTGCATCACGACGCGCCGCATCCAGATTATGACTCT
GGTGACTATTACATACGACCCCAAACTTCTAGAGACGAAATAAGGGACACTGCAAAACACGAAAGAAAGATGAAG
AGAATTAAATTCAGAAAGGAGCAACGAGCTTTGGCTCGAGAGTGGGCTCTCGAAAATATAAACGAGGATGGAACA
AGCAAGGAAGTCGCTTCTTCCAGAGAGAAAAAGAGGGCGCTTAATCTACTTCACAGGGAAATACGAGCTCAAAAA
TGGGCCATTACGAATTATAAAGTTGGAGAGCCCCTTCCACACACTACCAACATATATGAAGCAAATGCGCTTAAA
AAACTAGTTCACGAATCGAAAAGTCTCAAAAACCAAGAGAAACAGAACCAAGAAACTACTACATCTCCTTCATAG
Transcript >OphauG2|3600
ATGGCTTTGGCTCTACGTCCCGCATACCGCGCCACACGCCTCCTTACCTCGGTTCCTCTCAGATGCCTCAGCAGC
AAAACATCTGGCCCGCCACCGACCAAGGATCTCGACGTGGGCGAGCTTGAAGGTGCCTTGTTTCATATCAAGCCG
CTGGTGCGCGTGCACGAGCGGTCTGGTGTCAAACGCGCGCGTCTCCTCTATCAATCTCGCAAGCGCGGCACTCTG
GAAGCCGAGCTTTTATTCTCAACCTTTGCCTCCAAATATCTCGCCAATCTACCCCGTGCCATGCTCGAAGAATAT
GACCGACTACTCGACGAAAACGACTGGGACTTGTACTACTGGGCCACACAGCCCGATGAGTGTCCGCCGCCCAAC
CCCGAAGCCCAAAATCCAGCTCCTGCCGCCACCCCAACCTCTTCCAGCACTAAGCCGAAAACCACAGCCCCTCAA
GACTCCTTTGTACGCGAGACGCCTCCAGTGGGGGAATGGGCACAAACAGTCGGCAACATTCACCGGGCATATCGC
CCCGTGCCTGAACGCTGGCGTAACTCGCACATCTTGCGCCTCCTACGAGCCCACGTCAAGAATGGAAGCTCCGGC
TGCAATCCTGGGGGCTTGGGCTCTATGCCCCCTTTGGGGGTGCATCACGACGCGCCGCATCCAGATTATGACTCT
GGTGACTATTACATACGACCCCAAACTTCTAGAGACGAAATAAGGGACACTGCAAAACACGAAAGAAAGATGAAG
AGAATTAAATTCAGAAAGGAGCAACGAGCTTTGGCTCGAGAGTGGGCTCTCGAAAATATAAACGAGGATGGAACA
AGCAAGGAAGTCGCTTCTTCCAGAGAGAAAAAGAGGGCGCTTAATCTACTTCACAGGGAAATACGAGCTCAAAAA
TGGGCCATTACGAATTATAAAGTTGGAGAGCCCCTTCCACACACTACCAACATATATGAAGCAAATGCGCTTAAA
AAACTAGTTCACGAATCGAAAAGTCTCAAAAACCAAGAGAAACAGAACCAAGAAACTACTACATCTCCTTCATAG
Gene >OphauG2|3600
ATGGCTTTGGCTCTACGTCCCGCATACCGCGCCACACGCCTCCTTACCTCGGTTCCTCTCAGATGCCTCAGCAGC
AAAACATCTGGCCCGCCACCGACCAAGGATCTCGACGTGGGCGAGCTTGAAGGTGCCTTGTTTCATATCAAGCCG
CTGGTGCGCGTGCACGAGCGGTCTGGTGTCAAACGCGCGCGTCTCCTCTGTATGCCTCTTCTTCCTCATTTACAC
GCCTGGGAAGAAGAATACTCCTCTTCCTCAAGAAGCAGAAAAGTCTTGTTTACTTCTCCATCAACTAACAAGCCG
TCGTCCAGATCAATCTCGCAAGCGCGGCACTCTGGAAGCCGAGCTTTTATTCTCAACCTTTGCCTCCAAATATCT
CGCCAATCTACCCCGTGCCATGCTCGAAGAATATGACCGACTACTCGACGAAAACGACTGGGACTTGTACTACTG
GGCCACACAGCCCGATGAGTGTCCGCCGCCCAACCCCGAAGCCCAAAATCCAGCTCCTGCCGCCACCCCAACCTC
TTCCAGCACTAAGCCGAAAACCACAGCCCCTCAAGACTCCTTTGTACGCGAGACGCCTCCAGTGGGGGAATGGGC
ACAAACAGTCGGCAACATTCACCGGGCATATCGCCCCGTGCCTGAACGCTGGCGTAACTCGCACATCTTGCGCCT
CCTACGAGCCCACGTCAAGAATGGAAGCTCCGGCTGCAATCCTGGGGGCTTGGGCTCTATGCCCCCTTTGGGGGT
GCATCACGACGCGCCGCATCCAGATTATGACTCTGGTGACTATTACATACGACCCCAAACTTCTAGAGACGAAAT
AAGGGACACTGCAAAACACGAAAGAAAGATGAAGAGAATTAAATTCAGAAAGGAGCAACGAGCTTTGGCTCGAGA
GTGGGCTCTCGAAAATATAAACGAGGATGGAACAAGCAAGGAAGTCGCTTCTTCCAGAGAGAAAAAGAGGGCGCT
TAATCTACTTCACAGGGAAATACGAGCTCAAAAATGGGCCATTACGAATTATAAAGTTGGAGAGCCCCTTCCACA
CACTACCAACATATATGAAGCAAATGCGCTTAAAAAACTAGTTCACGAATCGAAAAGTCTCAAAAACCAAGAGAA
ACAGAACCAAGAAACTACTACATCTCCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail