Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|359
Gene name
LocationContig_108:21257..22570
Strand+
Gene length (bp)1313
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01264 Chorismate_synt Chorismate synthase 6.7E-139 8 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12640|AROC_NEUCR Chorismate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-2 PE=2 SV=2 1 407 0.0E+00
sp|P28777|AROC_YEAST Chorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO2 PE=1 SV=1 1 407 3.0E-167
sp|O74413|AROC_SCHPO Chorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.14 PE=3 SV=2 1 407 7.0E-167
sp|Q6AIP3|AROC_DESPS Chorismate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=aroC PE=3 SV=2 2 407 4.0E-142
sp|Q42884|AROC1_SOLLC Chorismate synthase 1, chloroplastic OS=Solanum lycopersicum GN=CS1 PE=2 SV=1 2 407 3.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12640|AROC_NEUCR Chorismate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-2 PE=2 SV=2 1 407 0.0E+00
sp|P28777|AROC_YEAST Chorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO2 PE=1 SV=1 1 407 3.0E-167
sp|O74413|AROC_SCHPO Chorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.14 PE=3 SV=2 1 407 7.0E-167
sp|Q6AIP3|AROC_DESPS Chorismate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=aroC PE=3 SV=2 2 407 4.0E-142
sp|Q42884|AROC1_SOLLC Chorismate synthase 1, chloroplastic OS=Solanum lycopersicum GN=CS1 PE=2 SV=1 2 407 3.0E-124
sp|Q7V364|AROC_PROMP Chorismate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=aroC PE=3 SV=1 2 407 8.0E-123
sp|A5GIL9|AROC_SYNPW Chorismate synthase OS=Synechococcus sp. (strain WH7803) GN=aroC PE=3 SV=1 2 407 9.0E-122
sp|Q42885|AROC2_SOLLC Chorismate synthase 2, chloroplastic OS=Solanum lycopersicum GN=CS2 PE=2 SV=1 2 407 1.0E-121
sp|B1ZUM3|AROC_OPITP Chorismate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroC PE=3 SV=1 2 407 2.0E-121
sp|A3PAU4|AROC_PROM0 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroC PE=3 SV=1 2 412 2.0E-121
sp|A9BDJ2|AROC_PROM4 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=aroC PE=3 SV=1 2 407 3.0E-121
sp|B1XIM6|AROC_SYNP2 Chorismate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroC PE=3 SV=1 2 412 1.0E-120
sp|A2BP22|AROC_PROMS Chorismate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroC PE=3 SV=1 2 412 2.0E-120
sp|Q31RS5|AROC_SYNE7 Chorismate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=aroC PE=3 SV=1 2 407 2.0E-120
sp|A2BUK4|AROC_PROM5 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroC PE=3 SV=1 2 407 2.0E-120
sp|B7KIU0|AROC_CYAP7 Chorismate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroC PE=3 SV=1 2 411 2.0E-120
sp|P57720|AROC_ARATH Chorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=EMB1144 PE=2 SV=2 2 407 4.0E-120
sp|Q5N2I0|AROC_SYNP6 Chorismate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroC PE=3 SV=1 2 407 2.0E-119
sp|Q8DLM1|AROC_THEEB Chorismate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroC PE=3 SV=1 2 407 3.0E-119
sp|Q31CV7|AROC_PROM9 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroC PE=3 SV=1 2 407 4.0E-119
sp|B7JVZ9|AROC_CYAP8 Chorismate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroC PE=3 SV=1 2 407 8.0E-119
sp|P27793|AROC_CAPSE Chorismate synthase, chloroplastic OS=Capnoides sempervirens PE=1 SV=1 2 414 8.0E-119
sp|Q3AUR6|AROC_SYNS9 Chorismate synthase OS=Synechococcus sp. (strain CC9902) GN=aroC PE=3 SV=1 2 407 3.0E-118
sp|A8G2N2|AROC_PROM2 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroC PE=3 SV=1 2 407 3.0E-118
sp|Q110N5|AROC_TRIEI Chorismate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=aroC PE=3 SV=1 2 409 1.0E-117
sp|Q7U9F0|AROC_SYNPX Chorismate synthase OS=Synechococcus sp. (strain WH8102) GN=aroC PE=3 SV=1 2 407 3.0E-117
sp|P23353|AROC_SYNY3 Chorismate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroC PE=3 SV=2 2 409 4.0E-117
sp|P46894|AROC_PROMA Chorismate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroC PE=3 SV=2 2 407 9.0E-117
sp|A5GW34|AROC_SYNR3 Chorismate synthase OS=Synechococcus sp. (strain RCC307) GN=aroC PE=3 SV=1 2 407 9.0E-117
sp|Q0ID82|AROC_SYNS3 Chorismate synthase OS=Synechococcus sp. (strain CC9311) GN=aroC PE=3 SV=1 2 407 1.0E-116
sp|B1WRV7|AROC_CYAA5 Chorismate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroC PE=3 SV=1 2 409 3.0E-116
sp|B2J1W7|AROC_NOSP7 Chorismate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroC PE=3 SV=1 2 409 4.0E-116
sp|B3DXL0|AROC_METI4 Chorismate synthase OS=Methylacidiphilum infernorum (isolate V4) GN=aroC PE=3 SV=1 2 406 1.0E-115
sp|A2C058|AROC_PROM1 Chorismate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=aroC PE=3 SV=1 2 407 3.0E-115
sp|Q46HE7|AROC_PROMT Chorismate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=aroC PE=3 SV=1 2 407 4.0E-115
sp|Q11Y57|AROC_CYTH3 Chorismate synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=aroC PE=3 SV=1 2 406 5.0E-115
sp|Q3AMV2|AROC_SYNSC Chorismate synthase OS=Synechococcus sp. (strain CC9605) GN=aroC PE=3 SV=2 2 407 5.0E-115
sp|B0C2W2|AROC_ACAM1 Chorismate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroC PE=3 SV=1 2 409 1.0E-114
sp|Q2JXD0|AROC_SYNJA Chorismate synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=aroC PE=3 SV=1 2 413 2.0E-114
sp|Q8YYP9|AROC_NOSS1 Chorismate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroC PE=3 SV=1 2 409 3.0E-114
sp|Q3MFM3|AROC_ANAVT Chorismate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroC PE=3 SV=1 2 409 3.0E-114
sp|Q7V4Y9|AROC_PROMM Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=aroC PE=3 SV=1 2 407 3.0E-114
sp|A2CCA2|AROC_PROM3 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=aroC PE=3 SV=1 2 407 3.0E-114
sp|A0M1V5|AROC_GRAFK Chorismate synthase OS=Gramella forsetii (strain KT0803) GN=aroC PE=3 SV=2 2 406 1.0E-113
sp|B8HNK4|AROC_CYAP4 Chorismate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroC PE=3 SV=1 2 407 2.0E-113
sp|B0JWQ2|AROC_MICAN Chorismate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroC PE=3 SV=1 2 410 3.0E-113
sp|Q2JLD4|AROC_SYNJB Chorismate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=aroC PE=3 SV=1 2 407 6.0E-113
sp|A6LDP9|AROC_PARD8 Chorismate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=aroC PE=3 SV=1 1 407 6.0E-113
sp|A6GXP5|AROC_FLAPJ Chorismate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=aroC PE=3 SV=1 2 402 8.0E-112
sp|A5FB38|AROC_FLAJ1 Chorismate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=aroC PE=3 SV=1 2 402 9.0E-112
sp|Q04XD2|AROC_LEPBL Chorismate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=aroC PE=3 SV=1 2 406 2.0E-111
sp|Q04W40|AROC_LEPBJ Chorismate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=aroC PE=3 SV=1 2 406 2.0E-111
sp|B0SRH8|AROC_LEPBP Chorismate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=aroC PE=3 SV=1 2 406 5.0E-111
sp|B0SHV8|AROC_LEPBA Chorismate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=aroC PE=3 SV=1 2 406 5.0E-111
sp|Q8F9N4|AROC_LEPIN Chorismate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=aroC PE=3 SV=1 2 406 8.0E-111
sp|Q72W01|AROC_LEPIC Chorismate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=aroC PE=3 SV=1 2 406 8.0E-111
sp|A8Z5Z2|AROC_SULMW Chorismate synthase OS=Sulcia muelleri (strain GWSS) GN=aroC PE=3 SV=1 2 402 4.0E-109
sp|Q8A602|AROC_BACTN Chorismate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=aroC PE=3 SV=1 1 402 1.0E-108
sp|Q64PP7|AROC_BACFR Chorismate synthase OS=Bacteroides fragilis (strain YCH46) GN=aroC PE=3 SV=1 1 402 2.0E-108
sp|Q5L9G0|AROC_BACFN Chorismate synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=aroC PE=3 SV=1 1 402 2.0E-107
sp|B2UNJ5|AROC_AKKM8 Chorismate synthase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=aroC PE=3 SV=1 2 407 9.0E-107
sp|A6L3D0|AROC_BACV8 Chorismate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=aroC PE=3 SV=1 1 402 5.0E-104
sp|Q65U87|AROC_MANSM Chorismate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroC PE=3 SV=1 2 407 3.0E-102
sp|A7NQM2|AROC_ROSCS Chorismate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=aroC PE=3 SV=1 2 404 9.0E-102
sp|A5UUN7|AROC_ROSS1 Chorismate synthase OS=Roseiflexus sp. (strain RS-1) GN=aroC PE=3 SV=1 2 404 2.0E-101
sp|Q46CJ6|AROC_METBF Chorismate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aroC PE=3 SV=1 2 402 2.0E-101
sp|Q87MM9|AROC_VIBPA Chorismate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroC PE=3 SV=1 2 412 6.0E-100
sp|Q7MIT1|AROC_VIBVY Chorismate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroC PE=3 SV=2 2 412 2.0E-99
sp|Q12X75|AROC_METBU Chorismate synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aroC PE=3 SV=1 2 402 2.0E-99
sp|Q8DB42|AROC_VIBVU Chorismate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroC PE=3 SV=1 2 412 2.0E-99
sp|Q0W6Q8|AROC_METAR Chorismate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=aroC PE=3 SV=1 2 403 2.0E-99
sp|Q8TT87|AROC_METAC Chorismate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aroC PE=3 SV=1 2 402 4.0E-99
sp|A0B5I7|AROC_METTP Chorismate synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=aroC PE=3 SV=1 2 406 4.0E-99
sp|P39198|AROC_VIBA7 Chorismate synthase OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=aroC PE=3 SV=3 2 413 6.0E-99
sp|A6VMY7|AROC_ACTSZ Chorismate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroC PE=3 SV=1 2 409 8.0E-99
sp|B8GB37|AROC_CHLAD Chorismate synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=aroC PE=3 SV=1 2 405 8.0E-99
sp|B9LK59|AROC_CHLSY Chorismate synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=aroC PE=3 SV=1 2 405 2.0E-98
sp|A9WI34|AROC_CHLAA Chorismate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=aroC PE=3 SV=1 2 405 2.0E-98
sp|A7MS71|AROC_VIBCB Chorismate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroC PE=3 SV=2 2 412 6.0E-98
sp|P43875|AROC_HAEIN Chorismate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroC PE=3 SV=1 2 409 7.0E-98
sp|A1S7K8|AROC_SHEAM Chorismate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroC PE=3 SV=1 2 411 2.0E-96
sp|A5UFZ9|AROC_HAEIG Chorismate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroC PE=3 SV=1 2 409 2.0E-96
sp|A5UAV8|AROC_HAEIE Chorismate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroC PE=3 SV=1 2 409 3.0E-96
sp|Q4QNZ4|AROC_HAEI8 Chorismate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroC PE=3 SV=1 2 409 4.0E-96
sp|Q9ZHE9|AROC_BUCAP Chorismate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroC PE=3 SV=2 2 409 7.0E-95
sp|B8D703|AROC_BUCAT Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=aroC PE=3 SV=1 2 410 7.0E-95
sp|P57198|AROC_BUCAI Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroC PE=3 SV=1 2 410 7.0E-95
sp|B8D8P9|AROC_BUCA5 Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=aroC PE=3 SV=1 2 410 7.0E-95
sp|B4RU03|AROC_ALTMD Chorismate synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=aroC PE=3 SV=1 2 411 8.0E-95
sp|Q8PW84|AROC_METMA Chorismate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aroC PE=3 SV=1 2 402 1.0E-94
sp|B0BP27|AROC_ACTPJ Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aroC PE=3 SV=1 2 409 6.0E-94
sp|B3GXI4|AROC_ACTP7 Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroC PE=3 SV=1 2 409 6.0E-94
sp|A1RIA0|AROC_SHESW Chorismate synthase OS=Shewanella sp. (strain W3-18-1) GN=aroC PE=3 SV=1 2 411 7.0E-94
sp|A9KTV7|AROC_SHEB9 Chorismate synthase OS=Shewanella baltica (strain OS195) GN=aroC PE=3 SV=1 2 411 7.0E-94
sp|A6WQ14|AROC_SHEB8 Chorismate synthase OS=Shewanella baltica (strain OS185) GN=aroC PE=3 SV=1 2 411 7.0E-94
sp|A3D676|AROC_SHEB5 Chorismate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroC PE=3 SV=1 2 411 7.0E-94
sp|B8EEA7|AROC_SHEB2 Chorismate synthase OS=Shewanella baltica (strain OS223) GN=aroC PE=3 SV=1 2 411 9.0E-94
sp|Q58575|AROC_METJA Chorismate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aroC PE=3 SV=1 1 402 2.0E-93
sp|A3N0B0|AROC_ACTP2 Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroC PE=3 SV=1 2 409 3.0E-93
sp|B8F415|AROC_HAEPS Chorismate synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=aroC PE=3 SV=1 2 409 4.0E-93
sp|Q47ZC3|AROC_COLP3 Chorismate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroC PE=3 SV=1 2 417 4.0E-93
sp|Q47HR7|AROC_DECAR Chorismate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroC PE=3 SV=1 2 407 5.0E-93
sp|B0UWQ4|AROC_HISS2 Chorismate synthase OS=Histophilus somni (strain 2336) GN=aroC PE=3 SV=1 2 409 6.0E-93
sp|Q0I3U1|AROC_HAES1 Chorismate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroC PE=3 SV=1 2 409 6.0E-93
sp|Q3J713|AROC_NITOC Chorismate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=aroC PE=3 SV=1 2 416 7.0E-93
sp|A4Y889|AROC_SHEPC Chorismate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroC PE=3 SV=1 2 411 1.0E-92
sp|C4Z562|AROC_EUBE2 Chorismate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=aroC PE=3 SV=1 2 402 1.0E-92
sp|A1AW83|AROC_RUTMC Chorismate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aroC PE=3 SV=1 2 412 2.0E-92
sp|A0KKS7|AROC_AERHH Chorismate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=aroC PE=3 SV=1 2 411 3.0E-92
sp|C3LP65|AROC_VIBCM Chorismate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aroC PE=3 SV=1 2 414 2.0E-91
sp|Q9KQ85|AROC_VIBCH Chorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroC PE=3 SV=1 2 414 2.0E-91
sp|A5F6F4|AROC_VIBC3 Chorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aroC PE=3 SV=1 2 414 2.0E-91
sp|A6VXI7|AROC_MARMS Chorismate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroC PE=3 SV=1 2 416 2.0E-91
sp|P57840|AROC_PASMU Chorismate synthase OS=Pasteurella multocida (strain Pm70) GN=aroC PE=3 SV=1 2 407 2.0E-91
sp|B6YRU6|AROC_AZOPC Chorismate synthase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=aroC PE=3 SV=1 1 405 3.0E-91
sp|Q5E3U6|AROC_VIBF1 Chorismate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aroC PE=3 SV=1 2 412 3.0E-91
sp|Q15VM5|AROC_PSEA6 Chorismate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroC PE=3 SV=1 2 412 5.0E-91
sp|Q12P04|AROC_SHEDO Chorismate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroC PE=3 SV=1 2 411 6.0E-91
sp|Q2SJE4|AROC_HAHCH Chorismate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=aroC PE=3 SV=1 2 413 6.0E-91
sp|Q0A9B2|AROC_ALKEH Chorismate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=aroC PE=3 SV=1 2 407 6.0E-91
sp|A1U0Y3|AROC_MARHV Chorismate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=aroC PE=3 SV=1 2 414 1.0E-90
sp|Q6LNN4|AROC_PHOPR Chorismate synthase OS=Photobacterium profundum GN=aroC PE=3 SV=1 2 402 1.0E-90
sp|Q7VLX2|AROC_HAEDU Chorismate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroC PE=3 SV=1 2 402 1.0E-90
sp|A1STP2|AROC_PSYIN Chorismate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroC PE=3 SV=1 2 416 2.0E-90
sp|A1WY16|AROC_HALHL Chorismate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=aroC PE=3 SV=1 2 407 2.0E-90
sp|A4SM83|AROC_AERS4 Chorismate synthase OS=Aeromonas salmonicida (strain A449) GN=aroC PE=3 SV=1 2 411 4.0E-90
sp|Q8TXN1|AROC_METKA Chorismate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aroC PE=3 SV=1 1 402 4.0E-90
sp|O29587|AROC_ARCFU Chorismate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aroC PE=3 SV=1 1 404 5.0E-90
sp|Q07ZQ7|AROC_SHEFN Chorismate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroC PE=3 SV=1 2 412 5.0E-90
sp|B3PHF4|AROC_CELJU Chorismate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=aroC PE=3 SV=1 2 412 5.0E-90
sp|B5FGA8|AROC_VIBFM Chorismate synthase OS=Vibrio fischeri (strain MJ11) GN=aroC PE=3 SV=1 2 412 7.0E-90
sp|Q5QW40|AROC_IDILO Chorismate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroC PE=3 SV=1 2 406 9.0E-90
sp|Q6MCU1|AROC_PARUW Chorismate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=aroC PE=3 SV=1 2 402 1.0E-89
sp|B5EJT1|AROC_ACIF5 Chorismate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroC PE=3 SV=1 2 415 1.0E-89
sp|B7JC67|AROC_ACIF2 Chorismate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroC PE=3 SV=1 2 415 1.0E-89
sp|Q31FE3|AROC_THICR Chorismate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroC PE=3 SV=1 2 407 2.0E-89
sp|A6UPX8|AROC_METVS Chorismate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aroC PE=3 SV=1 1 403 2.0E-89
sp|B1XWC5|AROC_LEPCP Chorismate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=aroC PE=3 SV=1 2 407 6.0E-89
sp|A3QFN4|AROC_SHELP Chorismate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroC PE=3 SV=1 2 415 7.0E-89
sp|Q60AY5|AROC_METCA Chorismate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroC PE=3 SV=1 2 414 8.0E-89
sp|B2SF54|AROC_FRATM Chorismate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroC PE=3 SV=1 2 402 9.0E-89
sp|A4IYS7|AROC_FRATW Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroC PE=3 SV=1 2 402 9.0E-89
sp|Q5NGG6|AROC_FRATT Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroC PE=3 SV=1 2 402 9.0E-89
sp|A0Q4Z0|AROC_FRATN Chorismate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroC PE=3 SV=1 2 402 9.0E-89
sp|Q14HW8|AROC_FRAT1 Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroC PE=3 SV=1 2 402 9.0E-89
sp|Q3IJ50|AROC_PSEHT Chorismate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroC PE=3 SV=1 2 407 1.0E-88
sp|Q21IX8|AROC_SACD2 Chorismate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroC PE=3 SV=1 2 399 2.0E-88
sp|B4EZG9|AROC_PROMH Chorismate synthase OS=Proteus mirabilis (strain HI4320) GN=aroC PE=3 SV=1 2 407 3.0E-88
sp|Q7N299|AROC_PHOLL Chorismate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroC PE=3 SV=1 2 416 3.0E-88
sp|Q2GCF2|AROC_NOVAD Chorismate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=aroC PE=3 SV=1 1 410 6.0E-88
sp|Q5FPG9|AROC_GLUOX Chorismate synthase OS=Gluconobacter oxydans (strain 621H) GN=aroC PE=3 SV=1 2 407 1.0E-87
sp|Q5X2Y6|AROC_LEGPA Chorismate synthase OS=Legionella pneumophila (strain Paris) GN=aroC PE=3 SV=1 2 409 2.0E-87
sp|Q83D67|AROC_COXBU Chorismate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroC PE=3 SV=1 2 407 2.0E-87
sp|Q1QUP5|AROC_CHRSD Chorismate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=aroC PE=3 SV=1 2 414 2.0E-87
sp|Q0BNG4|AROC_FRATO Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroC PE=3 SV=1 2 402 2.0E-87
sp|Q2A549|AROC_FRATH Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroC PE=3 SV=1 2 402 2.0E-87
sp|A7NA74|AROC_FRATF Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroC PE=3 SV=1 2 402 2.0E-87
sp|A6T017|AROC_JANMA Chorismate synthase OS=Janthinobacterium sp. (strain Marseille) GN=aroC PE=3 SV=1 2 414 3.0E-87
sp|A5CX05|AROC_VESOH Chorismate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=aroC PE=3 SV=1 2 415 4.0E-87
sp|Q5ZT62|AROC_LEGPH Chorismate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aroC PE=3 SV=1 2 409 5.0E-87
sp|A5IEA1|AROC_LEGPC Chorismate synthase OS=Legionella pneumophila (strain Corby) GN=aroC PE=3 SV=1 2 409 5.0E-87
sp|Q89AX9|AROC_BUCBP Chorismate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroC PE=3 SV=1 2 402 5.0E-87
sp|Q5WUE6|AROC_LEGPL Chorismate synthase OS=Legionella pneumophila (strain Lens) GN=aroC PE=3 SV=1 2 409 7.0E-87
sp|C1DBU8|AROC_LARHH Chorismate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroC PE=3 SV=1 2 413 1.0E-86
sp|C5BAF2|AROC_EDWI9 Chorismate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroC PE=3 SV=1 2 414 1.0E-86
sp|A9AWF4|AROC_HERA2 Chorismate synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=aroC PE=3 SV=1 2 406 1.0E-86
sp|Q3SL02|AROC_THIDA Chorismate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroC PE=3 SV=1 2 407 2.0E-86
sp|C5BL71|AROC_TERTT Chorismate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aroC PE=3 SV=1 2 399 2.0E-86
sp|Q13WE6|AROC_BURXL Chorismate synthase OS=Burkholderia xenovorans (strain LB400) GN=aroC PE=3 SV=1 2 414 2.0E-86
sp|A0LE92|AROC_SYNFM Chorismate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=aroC PE=3 SV=1 2 402 3.0E-86
sp|Q9JT81|AROC_NEIMA Chorismate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroC PE=3 SV=1 2 414 4.0E-86
sp|A8FTS6|AROC_SHESH Chorismate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroC PE=3 SV=1 2 415 7.0E-86
sp|Q5F756|AROC_NEIG1 Chorismate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroC PE=3 SV=1 2 415 1.0E-85
sp|Q21TN3|AROC_RHOFT Chorismate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=aroC PE=3 SV=1 2 414 1.0E-85
sp|A1KV89|AROC_NEIMF Chorismate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroC PE=3 SV=1 2 413 1.0E-85
sp|A9M1Q2|AROC_NEIM0 Chorismate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aroC PE=3 SV=1 2 413 1.0E-85
sp|A9H0U2|AROC_GLUDA Chorismate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=aroC PE=3 SV=1 2 407 1.0E-85
sp|B4RN46|AROC_NEIG2 Chorismate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroC PE=3 SV=1 2 415 2.0E-85
sp|C4ZAX1|AROC_EUBR3 Chorismate synthase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=aroC PE=3 SV=1 2 404 2.0E-85
sp|Q2W6Y1|AROC_MAGSA Chorismate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=aroC PE=3 SV=1 4 402 2.0E-85
sp|A1VF90|AROC_DESVV Chorismate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=aroC PE=3 SV=1 2 408 2.0E-85
sp|B1KKS1|AROC_SHEWM Chorismate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroC PE=3 SV=1 2 415 2.0E-85
sp|Q9JY99|AROC_NEIMB Chorismate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroC PE=3 SV=1 2 414 2.0E-85
sp|Q7VRU6|AROC_BLOFL Chorismate synthase OS=Blochmannia floridanus GN=aroC PE=3 SV=1 2 409 4.0E-85
sp|Q72DN5|AROC_DESVH Chorismate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=aroC PE=3 SV=1 2 408 4.0E-85
sp|Q668V5|AROC_YERPS Chorismate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|B2K8I9|AROC_YERPB Chorismate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|B1JGG7|AROC_YERPY Chorismate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|A4TM78|AROC_YERPP Chorismate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|Q1CHK6|AROC_YERPN Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|A9R7W3|AROC_YERPG Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|Q8ZD41|AROC_YERPE Chorismate synthase OS=Yersinia pestis GN=aroC PE=3 SV=3 2 407 5.0E-85
sp|Q1C664|AROC_YERPA Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|A7FGK6|AROC_YERP3 Chorismate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|A1JK48|AROC_YERE8 Chorismate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aroC PE=3 SV=1 2 407 5.0E-85
sp|B2SZH3|AROC_BURPP Chorismate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=aroC PE=3 SV=1 2 414 5.0E-85
sp|B2JK28|AROC_BURP8 Chorismate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=aroC PE=3 SV=1 2 413 6.0E-85
sp|Q7NYT5|AROC_CHRVO Chorismate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aroC PE=3 SV=1 2 413 8.0E-85
sp|A9KQX0|AROC_CLOPH Chorismate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=aroC PE=3 SV=1 2 384 9.0E-85
sp|A9ABG9|AROC_BURM1 Chorismate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroC PE=3 SV=1 2 407 1.0E-84
sp|A1VQW9|AROC_POLNA Chorismate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=aroC PE=3 SV=1 2 414 1.0E-84
sp|A0KV84|AROC_SHESA Chorismate synthase OS=Shewanella sp. (strain ANA-3) GN=aroC PE=3 SV=1 2 411 2.0E-84
sp|Q0HWM5|AROC_SHESR Chorismate synthase OS=Shewanella sp. (strain MR-7) GN=aroC PE=3 SV=1 2 411 2.0E-84
sp|Q0HKC3|AROC_SHESM Chorismate synthase OS=Shewanella sp. (strain MR-4) GN=aroC PE=3 SV=1 2 411 2.0E-84
sp|A0LDR1|AROC_MAGMM Chorismate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=aroC PE=3 SV=1 2 406 2.0E-84
sp|Q5P1K1|AROC_AROAE Chorismate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroC PE=3 SV=1 2 412 3.0E-84
sp|Q2SVC0|AROC_BURTA Chorismate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=aroC PE=3 SV=1 2 412 4.0E-84
sp|Q7MV04|AROC_PORGI Chorismate synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=aroC PE=3 SV=1 1 406 4.0E-84
sp|B4E7H2|AROC_BURCJ Chorismate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroC PE=3 SV=1 2 407 5.0E-84
sp|A4JDS6|AROC_BURVG Chorismate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroC PE=3 SV=1 2 407 6.0E-84
sp|A6UUV1|AROC_META3 Chorismate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aroC PE=3 SV=1 1 402 7.0E-84
sp|B1K077|AROC_BURCC Chorismate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroC PE=3 SV=1 2 407 7.0E-84
sp|A0K6T5|AROC_BURCH Chorismate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroC PE=3 SV=1 2 407 7.0E-84
sp|Q1BWW8|AROC_BURCA Chorismate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroC PE=3 SV=1 2 407 7.0E-84
sp|A1TRH4|AROC_ACIAC Chorismate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=aroC PE=3 SV=1 2 407 1.0E-83
sp|A1V3K9|AROC_BURMS Chorismate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroC PE=3 SV=2 2 412 1.0E-83
sp|Q62KU7|AROC_BURMA Chorismate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroC PE=3 SV=1 2 412 1.0E-83
sp|A3MJ92|AROC_BURM7 Chorismate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroC PE=3 SV=2 2 412 1.0E-83
sp|Q63TK6|AROC_BURPS Chorismate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroC PE=3 SV=1 2 412 1.0E-83
sp|A3N8Q9|AROC_BURP6 Chorismate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroC PE=3 SV=1 2 412 1.0E-83
sp|Q3JT35|AROC_BURP1 Chorismate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroC PE=3 SV=2 2 412 1.0E-83
sp|A3NUG3|AROC_BURP0 Chorismate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroC PE=3 SV=1 2 412 1.0E-83
sp|Q1GZD3|AROC_METFK Chorismate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=aroC PE=3 SV=1 2 418 1.0E-83
sp|B2UGK8|AROC_RALPJ Chorismate synthase OS=Ralstonia pickettii (strain 12J) GN=aroC PE=3 SV=1 2 413 2.0E-83
sp|B1YNZ5|AROC_BURA4 Chorismate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroC PE=3 SV=1 2 407 2.0E-83
sp|A4G4F3|AROC_HERAR Chorismate synthase OS=Herminiimonas arsenicoxydans GN=aroC PE=3 SV=1 2 414 2.0E-83
sp|Q39H65|AROC_BURL3 Chorismate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroC PE=3 SV=1 2 407 2.0E-83
sp|C6DA85|AROC_PECCP Chorismate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroC PE=3 SV=1 2 407 2.0E-83
sp|Q6LXL7|AROC_METMP Chorismate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=aroC PE=3 SV=1 1 403 3.0E-83
sp|Q0BG24|AROC_BURCM Chorismate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroC PE=3 SV=1 2 407 3.0E-83
sp|A7MH70|AROC_CROS8 Chorismate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroC PE=3 SV=1 2 417 5.0E-83
sp|Q2LUC8|AROC_SYNAS Chorismate synthase OS=Syntrophus aciditrophicus (strain SB) GN=aroC PE=3 SV=1 2 406 5.0E-83
sp|A2SFP8|AROC_METPP Chorismate synthase OS=Methylibium petroleiphilum (strain PM1) GN=aroC PE=3 SV=1 2 407 9.0E-83
sp|A6VGS0|AROC_METM7 Chorismate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aroC PE=3 SV=1 1 403 2.0E-82
sp|A8GH82|AROC_SERP5 Chorismate synthase OS=Serratia proteamaculans (strain 568) GN=aroC PE=3 SV=1 2 407 2.0E-82
sp|A2S381|AROC_BURM9 Chorismate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroC PE=3 SV=2 2 412 2.0E-82
sp|C4L8D2|AROC_TOLAT Chorismate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroC PE=3 SV=1 2 414 3.0E-82
sp|A6TC15|AROC_KLEP7 Chorismate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroC PE=3 SV=1 2 414 3.0E-82
sp|Q492G9|AROC_BLOPB Chorismate synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=aroC PE=3 SV=1 2 411 4.0E-82
sp|Q058B0|AROC_BUCCC Chorismate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=aroC PE=3 SV=1 2 407 9.0E-82
sp|Q3BRK5|AROC_XANC5 Chorismate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=aroC PE=3 SV=1 2 407 1.0E-81
sp|B0RR76|AROC_XANCB Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=aroC PE=3 SV=1 2 407 1.0E-81
sp|B5XVW6|AROC_KLEP3 Chorismate synthase OS=Klebsiella pneumoniae (strain 342) GN=aroC PE=3 SV=1 2 414 1.0E-81
sp|Q6D2M6|AROC_PECAS Chorismate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroC PE=3 SV=1 2 407 2.0E-81
sp|Q8P7R0|AROC_XANCP Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=aroC PE=3 SV=1 2 407 2.0E-81
sp|Q4UWE0|AROC_XANC8 Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=aroC PE=3 SV=1 2 407 2.0E-81
sp|Q13BI7|AROC_RHOPS Chorismate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=aroC PE=3 SV=1 1 402 3.0E-81
sp|B7LLE1|AROC_ESCF3 Chorismate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aroC PE=3 SV=1 2 407 3.0E-81
sp|C6C0I6|AROC_DESAD Chorismate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=aroC PE=3 SV=1 2 405 4.0E-81
sp|Q0VPH7|AROC_ALCBS Chorismate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=aroC PE=3 SV=1 2 402 4.0E-81
sp|Q8PJ20|AROC_XANAC Chorismate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=aroC PE=3 SV=1 2 407 4.0E-81
sp|A4VM84|AROC_PSEU5 Chorismate synthase OS=Pseudomonas stutzeri (strain A1501) GN=aroC PE=3 SV=1 2 414 4.0E-81
sp|B0U6K0|AROC_XYLFM Chorismate synthase OS=Xylella fastidiosa (strain M12) GN=aroC PE=3 SV=1 2 417 6.0E-81
sp|C4K3S0|AROC_HAMD5 Chorismate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroC PE=3 SV=1 2 407 6.0E-81
sp|A4WCW2|AROC_ENT38 Chorismate synthase OS=Enterobacter sp. (strain 638) GN=aroC PE=3 SV=1 2 407 7.0E-81
sp|Q5GXQ6|AROC_XANOR Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=aroC PE=3 SV=1 2 407 8.0E-81
sp|B2SVP7|AROC_XANOP Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=aroC PE=3 SV=1 2 407 8.0E-81
sp|Q2P0T3|AROC_XANOM Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=aroC PE=3 SV=1 2 407 8.0E-81
sp|B8ESC6|AROC_METSB Chorismate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=aroC PE=3 SV=1 2 402 1.0E-80
sp|Q0AEP5|AROC_NITEC Chorismate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroC PE=3 SV=1 2 414 1.0E-80
sp|Q31YC9|AROC_SHIBS Chorismate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B2TWB1|AROC_SHIB3 Chorismate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|Q1R983|AROC_ECOUT Chorismate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroC PE=3 SV=3 2 407 1.0E-80
sp|A1ADH8|AROC_ECOK1 Chorismate synthase OS=Escherichia coli O1:K1 / APEC GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B7MG93|AROC_ECO45 Chorismate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|Q0KC14|AROC_CUPNH Chorismate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroC PE=3 SV=2 2 413 1.0E-80
sp|Q5LX60|AROC_RUEPO Chorismate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aroC PE=3 SV=1 1 402 1.0E-80
sp|Q0T2F6|AROC_SHIF8 Chorismate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|Q32DK8|AROC_SHIDS Chorismate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B1LLT5|AROC_ECOSM Chorismate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B7N5U1|AROC_ECOLU Chorismate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B1IXB6|AROC_ECOLC Chorismate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|P63609|AROC_ECOL6 Chorismate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroC PE=3 SV=2 2 407 1.0E-80
sp|Q0TFB7|AROC_ECOL5 Chorismate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B7M6L0|AROC_ECO8A Chorismate synthase OS=Escherichia coli O8 (strain IAI1) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B7MY06|AROC_ECO81 Chorismate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|B5YXX0|AROC_ECO5E Chorismate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|P63610|AROC_ECO57 Chorismate synthase OS=Escherichia coli O157:H7 GN=aroC PE=3 SV=2 2 407 1.0E-80
sp|A7ZPE5|AROC_ECO24 Chorismate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroC PE=3 SV=1 2 407 1.0E-80
sp|P12008|AROC_ECOLI Chorismate synthase OS=Escherichia coli (strain K12) GN=aroC PE=1 SV=4 2 407 2.0E-80
sp|A8A2J9|AROC_ECOHS Chorismate synthase OS=Escherichia coli O9:H4 (strain HS) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|B1X9K2|AROC_ECODH Chorismate synthase OS=Escherichia coli (strain K12 / DH10B) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|C4ZVM2|AROC_ECOBW Chorismate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|B8DRR9|AROC_DESVM Chorismate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=aroC PE=3 SV=1 2 405 2.0E-80
sp|B7NP10|AROC_ECO7I Chorismate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|B3QIL0|AROC_RHOPT Chorismate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroC PE=3 SV=1 1 410 2.0E-80
sp|Q6NAI4|AROC_RHOPA Chorismate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroC PE=3 SV=1 1 410 2.0E-80
sp|Q3YZN2|AROC_SHISS Chorismate synthase OS=Shigella sonnei (strain Ss046) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|Q83QQ5|AROC_SHIFL Chorismate synthase OS=Shigella flexneri GN=aroC PE=3 SV=4 2 407 2.0E-80
sp|B6I4X6|AROC_ECOSE Chorismate synthase OS=Escherichia coli (strain SE11) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|B7LBI3|AROC_ECO55 Chorismate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|B7UFY7|AROC_ECO27 Chorismate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroC PE=3 SV=1 2 407 2.0E-80
sp|Q89RY1|AROC_BRADU Chorismate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroC PE=3 SV=1 1 402 3.0E-80
sp|Q4ZVC2|AROC_PSEU2 Chorismate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroC PE=3 SV=1 2 414 4.0E-80
sp|Q9I344|AROC_PSEAE Chorismate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aroC PE=3 SV=1 2 413 6.0E-80
sp|Q02KH1|AROC_PSEAB Chorismate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aroC PE=3 SV=1 2 413 6.0E-80
sp|B7UV40|AROC_PSEA8 Chorismate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=aroC PE=3 SV=1 2 413 6.0E-80
sp|A4FWK1|AROC_METM5 Chorismate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aroC PE=3 SV=1 1 403 7.0E-80
sp|Q87DS4|AROC_XYLFT Chorismate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroC PE=3 SV=1 2 417 7.0E-80
sp|B2I9I6|AROC_XYLF2 Chorismate synthase OS=Xylella fastidiosa (strain M23) GN=aroC PE=3 SV=1 2 417 7.0E-80
sp|Q884P5|AROC_PSESM Chorismate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroC PE=3 SV=1 2 413 9.0E-80
sp|B5BBA5|AROC_SALPK Chorismate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroC PE=3 SV=1 2 407 2.0E-79
sp|Q5PCX2|AROC_SALPA Chorismate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroC PE=3 SV=1 2 407 2.0E-79
sp|Q07HS5|AROC_RHOP5 Chorismate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroC PE=3 SV=1 1 402 2.0E-79
sp|B4SQW1|AROC_STRM5 Chorismate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=aroC PE=3 SV=1 2 407 2.0E-79
sp|A4XTH9|AROC_PSEMY Chorismate synthase OS=Pseudomonas mendocina (strain ymp) GN=aroC PE=3 SV=1 2 413 3.0E-79
sp|B6IRC6|AROC_RHOCS Chorismate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=aroC PE=3 SV=1 2 406 3.0E-79
sp|A5VFP1|AROC_SPHWW Chorismate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=aroC PE=3 SV=1 1 407 3.0E-79
sp|B8FFQ6|AROC_DESAA Chorismate synthase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=aroC PE=3 SV=1 2 404 3.0E-79
sp|A4YQ28|AROC_BRASO Chorismate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=aroC PE=3 SV=2 1 402 3.0E-79
sp|B1XUP3|AROC_POLNS Chorismate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=aroC PE=3 SV=1 2 416 4.0E-79
sp|P58729|AROC_SALTY Chorismate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroC PE=3 SV=2 2 407 4.0E-79
sp|A9N460|AROC_SALPB Chorismate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroC PE=3 SV=1 2 407 4.0E-79
sp|B4SZQ7|AROC_SALNS Chorismate synthase OS=Salmonella newport (strain SL254) GN=aroC PE=3 SV=1 2 407 4.0E-79
sp|B4TCA5|AROC_SALHS Chorismate synthase OS=Salmonella heidelberg (strain SL476) GN=aroC PE=3 SV=1 2 407 4.0E-79
sp|Q57LX0|AROC_SALCH Chorismate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroC PE=3 SV=1 2 407 4.0E-79
sp|A6V7B0|AROC_PSEA7 Chorismate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=aroC PE=3 SV=1 2 413 4.0E-79
sp|Q7VY92|AROC_BORPE Chorismate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroC PE=3 SV=1 2 410 4.0E-79
sp|A5EEP1|AROC_BRASB Chorismate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroC PE=3 SV=1 1 402 4.0E-79
sp|A9MJ42|AROC_SALAR Chorismate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroC PE=3 SV=1 2 407 4.0E-79
sp|Q2NGS6|AROC_METST Chorismate synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aroC PE=3 SV=1 2 402 4.0E-79
sp|B4TQB9|AROC_SALSV Chorismate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|B5RCK9|AROC_SALG2 Chorismate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|B5R3R5|AROC_SALEP Chorismate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|B5FPM7|AROC_SALDC Chorismate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|B5EZR6|AROC_SALA4 Chorismate synthase OS=Salmonella agona (strain SL483) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|B9MAD0|AROC_ACIET Chorismate synthase OS=Acidovorax ebreus (strain TPSY) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|A1K498|AROC_AZOSB Chorismate synthase OS=Azoarcus sp. (strain BH72) GN=aroC PE=3 SV=1 2 407 5.0E-79
sp|Q48KN0|AROC_PSE14 Chorismate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroC PE=3 SV=1 2 414 6.0E-79
sp|A1WL18|AROC_VEREI Chorismate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=aroC PE=3 SV=1 2 407 6.0E-79
sp|Q7WKJ5|AROC_BORBR Chorismate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroC PE=3 SV=1 2 410 6.0E-79
sp|B2VIY1|AROC_ERWT9 Chorismate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroC PE=3 SV=1 2 413 7.0E-79
sp|B2FP01|AROC_STRMK Chorismate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=aroC PE=3 SV=1 2 407 8.0E-79
sp|O02607|AROC_TOXGO Chorismate synthase OS=Toxoplasma gondii GN=AROC PE=2 SV=1 1 289 8.0E-79
sp|A8ADP9|AROC_CITK8 Chorismate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroC PE=3 SV=1 2 407 8.0E-79
sp|Q1LPA2|AROC_CUPMC Chorismate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroC PE=3 SV=1 2 413 1.0E-78
sp|Q0BVN0|AROC_GRABC Chorismate synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=aroC PE=3 SV=2 2 407 1.0E-78
sp|A5FS06|AROC_DEHMB Chorismate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroC PE=3 SV=1 2 399 1.0E-78
sp|Q9PDL0|AROC_XYLFA Chorismate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroC PE=3 SV=2 2 417 2.0E-78
sp|Q8XZ40|AROC_RALSO Chorismate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroC PE=3 SV=1 2 413 2.0E-78
sp|Q3ZZI6|AROC_DEHMC Chorismate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroC PE=3 SV=1 2 399 2.0E-78
sp|Q18F10|AROC_HALWD Chorismate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aroC PE=3 SV=1 4 402 2.0E-78
sp|Q1GCR5|AROC_RUEST Chorismate synthase OS=Ruegeria sp. (strain TM1040) GN=aroC PE=3 SV=1 1 411 2.0E-78
sp|Q16CN2|AROC_ROSDO Chorismate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aroC PE=3 SV=1 1 402 2.0E-78
sp|Q472Q5|AROC_CUPPJ Chorismate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroC PE=3 SV=1 2 413 3.0E-78
sp|Q1LTA9|AROC_BAUCH Chorismate synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=aroC PE=3 SV=1 2 412 3.0E-78
sp|Q1QQ46|AROC_NITHX Chorismate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=aroC PE=3 SV=1 2 402 4.0E-78
sp|A4WWC0|AROC_RHOS5 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroC PE=3 SV=1 1 411 4.0E-78
sp|A8ZT68|AROC_DESOH Chorismate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=aroC PE=3 SV=1 2 406 4.0E-78
sp|B1J4S1|AROC_PSEPW Chorismate synthase OS=Pseudomonas putida (strain W619) GN=aroC PE=3 SV=1 2 413 4.0E-78
sp|Q5NLU3|AROC_ZYMMO Chorismate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=aroC PE=3 SV=1 1 407 4.0E-78
sp|Q4FN06|AROC_PELUB Chorismate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=aroC PE=3 SV=1 1 408 5.0E-78
sp|A1W6H4|AROC_ACISJ Chorismate synthase OS=Acidovorax sp. (strain JS42) GN=aroC PE=3 SV=1 2 407 5.0E-78
sp|Q12CG7|AROC_POLSJ Chorismate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=aroC PE=3 SV=1 2 416 6.0E-78
sp|Q7W950|AROC_BORPA Chorismate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroC PE=3 SV=1 2 410 8.0E-78
sp|B9LMX0|AROC_HALLT Chorismate synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=aroC PE=3 SV=1 4 402 9.0E-78
sp|A9IT47|AROC_BORPD Chorismate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=aroC PE=3 SV=1 2 407 1.0E-77
sp|Q3SUZ5|AROC_NITWN Chorismate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=aroC PE=3 SV=2 2 402 1.0E-77
sp|Q1ID65|AROC_PSEE4 Chorismate synthase OS=Pseudomonas entomophila (strain L48) GN=aroC PE=3 SV=1 2 413 1.0E-77
sp|Q21A81|AROC_RHOPB Chorismate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroC PE=3 SV=1 1 410 2.0E-77
sp|P16280|AROC_SALTI Chorismate synthase OS=Salmonella typhi GN=aroC PE=3 SV=4 2 407 2.0E-77
sp|Q88LU7|AROC_PSEPK Chorismate synthase OS=Pseudomonas putida (strain KT2440) GN=aroC PE=3 SV=1 2 414 2.0E-77
sp|A5W794|AROC_PSEP1 Chorismate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aroC PE=3 SV=1 2 414 2.0E-77
sp|Q2N810|AROC_ERYLH Chorismate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=aroC PE=3 SV=1 1 407 3.0E-77
sp|Q82TK9|AROC_NITEU Chorismate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroC PE=3 SV=1 2 416 3.0E-77
sp|Q2J0T8|AROC_RHOP2 Chorismate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=aroC PE=3 SV=1 1 402 5.0E-77
sp|Q4K8J3|AROC_PSEF5 Chorismate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aroC PE=3 SV=1 2 414 6.0E-77
sp|B0KUL0|AROC_PSEPG Chorismate synthase OS=Pseudomonas putida (strain GB-1) GN=aroC PE=3 SV=1 2 414 7.0E-77
sp|Q1GVE2|AROC_SPHAL Chorismate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=aroC PE=3 SV=1 1 407 1.0E-76
sp|Q2KYK7|AROC_BORA1 Chorismate synthase OS=Bordetella avium (strain 197N) GN=aroC PE=3 SV=1 2 399 3.0E-76
sp|Q3Z993|AROC_DEHM1 Chorismate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroC PE=3 SV=1 2 399 5.0E-76
sp|A7IMW7|AROC_XANP2 Chorismate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=aroC PE=3 SV=1 1 402 8.0E-76
sp|Q30NY4|AROC_SULDN Chorismate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=aroC PE=3 SV=1 1 402 9.0E-76
sp|A4SXH9|AROC_POLSQ Chorismate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=aroC PE=3 SV=1 2 407 1.0E-75
sp|B6JFJ0|AROC_OLICO Chorismate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=aroC PE=3 SV=1 1 402 1.0E-75
sp|Q2RR25|AROC_RHORT Chorismate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroC PE=3 SV=1 3 402 1.0E-75
sp|B2IDQ8|AROC_BEII9 Chorismate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=aroC PE=3 SV=1 2 402 1.0E-75
sp|B9KE09|AROC_CAMLR Chorismate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=aroC PE=3 SV=1 1 402 2.0E-75
sp|Q2Y7L8|AROC_NITMU Chorismate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroC PE=3 SV=1 2 414 2.0E-75
sp|A1URW3|AROC_BARBK Chorismate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=aroC PE=3 SV=1 2 402 2.0E-75
sp|B1M325|AROC_METRJ Chorismate synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=aroC PE=3 SV=1 2 410 2.0E-75
sp|A5FY49|AROC_ACICJ Chorismate synthase OS=Acidiphilium cryptum (strain JF-5) GN=aroC PE=3 SV=1 2 407 4.0E-75
sp|A8EV89|AROC_ARCB4 Chorismate synthase OS=Arcobacter butzleri (strain RM4018) GN=aroC PE=3 SV=1 1 402 6.0E-75
sp|Q1MKK1|AROC_RHIL3 Chorismate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aroC PE=3 SV=1 2 402 7.0E-75
sp|A1BA52|AROC_PARDP Chorismate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroC PE=3 SV=1 1 410 1.0E-74
sp|A6QCJ1|AROC_SULNB Chorismate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroC PE=3 SV=1 1 407 2.0E-74
sp|Q3KFJ1|AROC_PSEPF Chorismate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aroC PE=3 SV=1 2 414 2.0E-74
sp|C5CS25|AROC_VARPS Chorismate synthase OS=Variovorax paradoxus (strain S110) GN=aroC PE=3 SV=1 2 415 3.0E-74
sp|C3K084|AROC_PSEFS Chorismate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=aroC PE=3 SV=1 2 414 4.0E-74
sp|C3MHI8|AROC_RHISN Chorismate synthase OS=Rhizobium sp. (strain NGR234) GN=aroC PE=3 SV=1 2 402 7.0E-74
sp|A7HZN6|AROC_CAMHC Chorismate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=aroC PE=3 SV=1 1 402 7.0E-74
sp|Q2KBP0|AROC_RHIEC Chorismate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroC PE=3 SV=1 2 402 9.0E-74
sp|Q0ARD9|AROC_MARMM Chorismate synthase OS=Maricaulis maris (strain MCS10) GN=aroC PE=3 SV=1 2 406 1.0E-73
sp|Q255H5|AROC_CHLFF Chorismate synthase OS=Chlamydophila felis (strain Fe/C-56) GN=aroC PE=3 SV=1 4 404 1.0E-73
sp|B0VDX7|AROC_ACIBY Chorismate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroC PE=3 SV=1 2 407 1.0E-73
sp|A3M5C7|AROC_ACIBT Chorismate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroC PE=3 SV=2 2 407 1.0E-73
sp|B7I5W6|AROC_ACIB5 Chorismate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroC PE=3 SV=1 2 407 1.0E-73
sp|B7H3A6|AROC_ACIB3 Chorismate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroC PE=3 SV=1 2 407 1.0E-73
sp|B2I0B7|AROC_ACIBC Chorismate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroC PE=3 SV=1 2 407 1.0E-73
sp|B5ZST4|AROC_RHILW Chorismate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroC PE=3 SV=1 2 402 1.0E-73
sp|B0VPN2|AROC_ACIBS Chorismate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroC PE=3 SV=1 2 407 2.0E-73
sp|A5UNA1|AROC_METS3 Chorismate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=aroC PE=3 SV=1 2 402 5.0E-73
sp|B4RHV8|AROC_PHEZH Chorismate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroC PE=3 SV=1 2 410 8.0E-73
sp|B0BC02|AROC_CHLTB Chorismate synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=aroC PE=3 SV=1 4 392 1.0E-72
sp|B0B7T7|AROC_CHLT2 Chorismate synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=aroC PE=3 SV=1 4 392 1.0E-72
sp|O84373|AROC_CHLTR Chorismate synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=aroC PE=3 SV=1 4 392 1.0E-72
sp|Q2NSH3|AROC_SODGM Chorismate synthase OS=Sodalis glossinidius (strain morsitans) GN=aroC PE=3 SV=1 2 418 2.0E-72
sp|Q6FAR2|AROC_ACIAD Chorismate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroC PE=3 SV=1 2 407 3.0E-72
sp|Q3KLY8|AROC_CHLTA Chorismate synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=aroC PE=3 SV=1 4 392 3.0E-72
sp|Q96Y94|AROC_SULTO Chorismate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aroC PE=3 SV=1 2 402 4.0E-72
sp|Q822F8|AROC_CHLCV Chorismate synthase OS=Chlamydophila caviae (strain GPIC) GN=aroC PE=3 SV=1 4 404 4.0E-72
sp|Q5L5F2|AROC_CHLAB Chorismate synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=aroC PE=3 SV=1 4 404 5.0E-72
sp|A7HR75|AROC_PARL1 Chorismate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=aroC PE=3 SV=1 2 410 6.0E-72
sp|B0UJB1|AROC_METS4 Chorismate synthase OS=Methylobacterium sp. (strain 4-46) GN=aroC PE=3 SV=1 2 402 2.0E-71
sp|Q1QA91|AROC_PSYCK Chorismate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroC PE=3 SV=1 2 402 3.0E-71
sp|Q9Z6M2|AROC_CHLPN Chorismate synthase OS=Chlamydia pneumoniae GN=aroC PE=3 SV=1 2 404 5.0E-71
sp|Q11KE5|AROC_CHESB Chorismate synthase OS=Chelativorans sp. (strain BNC1) GN=aroC PE=3 SV=1 2 402 6.0E-71
sp|Q28VL4|AROC_JANSC Chorismate synthase OS=Jannaschia sp. (strain CCS1) GN=aroC PE=3 SV=1 1 410 7.0E-71
sp|Q980I7|AROC_SULSO Chorismate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aroC PE=3 SV=1 2 402 3.0E-70
sp|Q9HJY7|AROC_THEAC Chorismate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aroC PE=3 SV=1 1 402 3.0E-70
sp|A3PFR1|AROC_RHOS1 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroC PE=3 SV=1 2 414 5.0E-70
sp|Q4FRQ5|AROC_PSYA2 Chorismate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroC PE=3 SV=1 2 402 5.0E-70
sp|A0RRM6|AROC_CAMFF Chorismate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=aroC PE=3 SV=1 1 402 5.0E-70
sp|A6Q1H1|AROC_NITSB Chorismate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroC PE=3 SV=1 1 402 6.0E-70
sp|A6WWB6|AROC_OCHA4 Chorismate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=aroC PE=3 SV=1 2 402 6.0E-70
sp|B9KQP8|AROC_RHOSK Chorismate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroC PE=3 SV=1 2 414 1.0E-69
sp|Q3IY15|AROC_RHOS4 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroC PE=3 SV=1 2 414 1.0E-69
sp|Q985Z4|AROC_RHILO Chorismate synthase OS=Rhizobium loti (strain MAFF303099) GN=aroC PE=3 SV=1 2 402 1.0E-69
sp|Q9YEL4|AROC_AERPE Chorismate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aroC PE=3 SV=1 3 396 1.0E-69
sp|B8J4Q3|AROC_DESDA Chorismate synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=aroC PE=3 SV=1 2 390 1.0E-69
sp|B3PS94|AROC_RHIE6 Chorismate synthase OS=Rhizobium etli (strain CIAT 652) GN=aroC PE=3 SV=1 2 402 2.0E-69
sp|C0RHD5|AROC_BRUMB Chorismate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=aroC PE=3 SV=1 2 402 6.0E-69
sp|Q5V5K5|AROC_HALMA Chorismate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aroC PE=3 SV=1 2 402 7.0E-69
sp|Q7M841|AROC_WOLSU Chorismate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=aroC PE=3 SV=1 1 412 9.0E-69
sp|P63608|AROC_BRUSU Chorismate synthase OS=Brucella suis biovar 1 (strain 1330) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|B0CKB2|AROC_BRUSI Chorismate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|A5VP02|AROC_BRUO2 Chorismate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|P63607|AROC_BRUME Chorismate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|A9M8V2|AROC_BRUC2 Chorismate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|Q57ET8|AROC_BRUAB Chorismate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|Q2YMF8|AROC_BRUA2 Chorismate synthase OS=Brucella abortus (strain 2308) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|B2S9R7|AROC_BRUA1 Chorismate synthase OS=Brucella abortus (strain S19) GN=aroC PE=3 SV=1 2 402 9.0E-69
sp|A9W6U7|AROC_METEP Chorismate synthase OS=Methylobacterium extorquens (strain PA1) GN=aroC PE=3 SV=1 2 399 1.0E-68
sp|A6U6U1|AROC_SINMW Chorismate synthase OS=Sinorhizobium medicae (strain WSM419) GN=aroC PE=3 SV=1 2 402 2.0E-68
sp|B7KT24|AROC_METC4 Chorismate synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=aroC PE=3 SV=1 2 399 3.0E-68
sp|Q4JC74|AROC_SULAC Chorismate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aroC PE=3 SV=1 2 399 3.0E-68
sp|B9JSM6|AROC_AGRVS Chorismate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=aroC PE=3 SV=1 2 402 6.0E-68
sp|A5EXT0|AROC_DICNV Chorismate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroC PE=3 SV=1 2 407 7.0E-68
sp|C3MZF2|AROC_SULIA Chorismate synthase OS=Sulfolobus islandicus (strain M.16.27) GN=aroC PE=3 SV=1 2 402 2.0E-67
sp|C3N7H4|AROC_SULIY Chorismate synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=aroC PE=3 SV=1 2 402 2.0E-67
sp|C3MXK6|AROC_SULIM Chorismate synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=aroC PE=3 SV=1 2 402 2.0E-67
sp|C3MRB7|AROC_SULIL Chorismate synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=aroC PE=3 SV=1 2 402 2.0E-67
sp|C4KIN2|AROC_SULIK Chorismate synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=aroC PE=3 SV=1 2 402 2.0E-67
sp|E3PV41|AROC_CLOSD Chorismate synthase OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=aroC PE=3 SV=1 2 404 2.0E-67
sp|Q9PK26|AROC_CHLMU Chorismate synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=aroC PE=3 SV=1 4 392 4.0E-67
sp|Q0C3Z3|AROC_HYPNA Chorismate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=aroC PE=3 SV=1 2 402 4.0E-67
sp|C7PC56|AROC_CHIPD Chorismate synthase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=aroC PE=3 SV=1 1 405 5.0E-67
sp|C3NG02|AROC_SULIN Chorismate synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=aroC PE=3 SV=1 2 402 6.0E-67
sp|A8I4M5|AROC_AZOC5 Chorismate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=aroC PE=3 SV=1 1 402 6.0E-67
sp|Q97AR9|AROC_THEVO Chorismate synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aroC PE=3 SV=1 1 402 7.0E-67
sp|B1ZHL0|AROC_METPB Chorismate synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=aroC PE=3 SV=1 2 410 1.0E-66
sp|Q73NM0|AROC_TREDE Chorismate synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=aroC PE=3 SV=1 2 403 1.0E-66
sp|A5WDY8|AROC_PSYWF Chorismate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=aroC PE=3 SV=1 2 414 1.0E-66
sp|A8LMT3|AROC_DINSH Chorismate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=aroC PE=3 SV=1 1 402 2.0E-66
sp|Q9HQC2|AROC_HALSA Chorismate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aroC PE=3 SV=1 4 402 3.0E-66
sp|B1L5G9|AROC_KORCO Chorismate synthase OS=Korarchaeum cryptofilum (strain OPF8) GN=aroC PE=3 SV=1 4 402 5.0E-66
sp|B8IS51|AROC_METNO Chorismate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=aroC PE=3 SV=1 2 402 7.0E-66
sp|Q30XS4|AROC_DESAG Chorismate synthase OS=Desulfovibrio alaskensis (strain G20) GN=aroC PE=3 SV=1 2 405 7.0E-66
sp|A4YHW1|AROC_METS5 Chorismate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=aroC PE=3 SV=1 2 399 1.0E-65
sp|Q7D0R6|AROC_AGRFC Chorismate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aroC PE=3 SV=2 2 402 2.0E-65
sp|A7H187|AROC_CAMC5 Chorismate synthase OS=Campylobacter curvus (strain 525.92) GN=aroC PE=3 SV=1 1 402 2.0E-65
sp|C7NZH8|AROC_HALMD Chorismate synthase OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=aroC PE=3 SV=1 2 402 9.0E-65
sp|A8A9W1|AROC_IGNH4 Chorismate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=aroC PE=3 SV=1 2 399 2.0E-64
sp|Q92RH3|AROC_RHIME Chorismate synthase OS=Rhizobium meliloti (strain 1021) GN=aroC PE=3 SV=1 2 402 2.0E-64
sp|A8MC69|AROC_CALMQ Chorismate synthase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=aroC PE=3 SV=1 1 399 7.0E-64
sp|Q6MHP7|AROC_BDEBA Chorismate synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=aroC PE=3 SV=1 2 402 7.0E-64
sp|Q9A3P8|AROC_CAUCR Chorismate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroC PE=3 SV=1 2 402 8.0E-64
sp|B8H3W7|AROC_CAUCN Chorismate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=aroC PE=3 SV=1 2 402 8.0E-64
sp|Q7VIA8|AROC_HELHP Chorismate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=aroC PE=3 SV=1 1 409 1.0E-63
sp|C5A782|AROC_THEGJ Chorismate synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=aroC PE=3 SV=1 5 406 2.0E-63
sp|A3DDD8|AROC_CLOTH Chorismate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroC PE=3 SV=1 2 408 2.0E-63
sp|Q9V1H0|AROC_PYRAB Chorismate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aroC PE=3 SV=1 5 406 7.0E-63
sp|Q5JFT4|AROC_THEKO Chorismate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aroC PE=3 SV=1 5 406 1.0E-62
sp|A3MUI8|AROC_PYRCJ Chorismate synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=aroC PE=3 SV=1 1 402 2.0E-62
sp|A8FNU6|AROC_CAMJ8 Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=aroC PE=3 SV=1 1 402 7.0E-62
sp|Q6G0D7|AROC_BARQU Chorismate synthase OS=Bartonella quintana (strain Toulouse) GN=aroC PE=3 SV=1 2 402 2.0E-61
sp|Q6G4D4|AROC_BARHE Chorismate synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=aroC PE=3 SV=1 2 402 2.0E-61
sp|Q8ZW90|AROC_PYRAE Chorismate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aroC PE=3 SV=1 1 399 2.0E-61
sp|Q9PM41|AROC_CAMJE Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=aroC PE=1 SV=1 1 402 6.0E-61
sp|Q9ZLH1|AROC_HELPJ Chorismate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aroC PE=3 SV=1 1 402 6.0E-61
sp|Q5HSF9|AROC_CAMJR Chorismate synthase OS=Campylobacter jejuni (strain RM1221) GN=aroC PE=3 SV=1 1 402 9.0E-61
sp|P56122|AROC_HELPY Chorismate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aroC PE=1 SV=1 1 402 2.0E-60
sp|A7H5Y1|AROC_CAMJD Chorismate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=aroC PE=3 SV=1 1 402 2.0E-60
sp|A1W1N6|AROC_CAMJJ Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=aroC PE=3 SV=1 1 402 3.0E-60
sp|A8Z6F5|AROC_CAMC1 Chorismate synthase OS=Campylobacter concisus (strain 13826) GN=aroC PE=3 SV=1 1 402 4.0E-60
sp|B5Z736|AROC_HELPG Chorismate synthase OS=Helicobacter pylori (strain G27) GN=aroC PE=3 SV=1 1 402 5.0E-60
sp|Q17XJ5|AROC_HELAH Chorismate synthase OS=Helicobacter acinonychis (strain Sheeba) GN=aroC PE=3 SV=1 1 402 7.0E-60
sp|E0TIQ1|AROC_ZINIC Chorismate synthase OS=Zinderia insecticola (strain CARI) GN=aroC PE=3 SV=1 2 402 7.0E-60
sp|B6JLQ1|AROC_HELP2 Chorismate synthase OS=Helicobacter pylori (strain P12) GN=aroC PE=3 SV=1 1 402 7.0E-60
sp|B2UTG3|AROC_HELPS Chorismate synthase OS=Helicobacter pylori (strain Shi470) GN=aroC PE=3 SV=1 1 402 1.0E-59
sp|O02607|AROC_TOXGO Chorismate synthase OS=Toxoplasma gondii GN=AROC PE=2 SV=1 321 407 1.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0004107 chorismate synthase activity Yes
GO:0009073 aromatic amino acid family biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0009072 aromatic amino acid family metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0016829 lyase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006725 cellular aromatic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|359 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2917
Ophiocordyceps camponoti-floridani Ophcf2|03777
Ophiocordyceps camponoti-rufipedis Ophun1|3909
Ophiocordyceps kimflemingae Ophio5|4990
Ophiocordyceps subramaniannii Hirsu2|3115

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|359
MSTFGHHFRITTAGESHGRSVSCIIDNCPPGLALTEADIQPQLNRRRPGQSAITTPRDEKDLVTIHSGTEAGRTL
GTPILLTVPNQDQRPHDYGDSTIDLYPRPSHADWTYLEKYGIKASSGGGRSSARETIARVAAGAVADKWLRQTYG
VEIVAFVSSVGSIKLFPESHGEHGADALSSNAHFLSLASSITRAEVDQFLPVRCPDAAAAAAMEKRIAELRDLHD
STGGTVTCVIRNTPPGLGEPCFDKLEALLAHAMLSIPAVKGFEIGSGFCGAEMTGSKHNDPFVPSGQPTGVTQVG
VDSEAGLHTRATQAAGIPASRLATSTNHSGGIQGGISNGMPIFFRVAFKPPATISRDQTTARYDASASGVLAAKG
RHDPCVVPRAVPIVEAMAALTIADALMAQHARAQGISVTASCRN*
Coding >OphauG2|359
ATGTCCACCTTTGGCCACCATTTCCGCATCACCACAGCCGGCGAGTCGCACGGTCGCTCCGTCTCGTGCATCATT
GACAATTGCCCTCCCGGCCTGGCTCTCACCGAAGCCGATATCCAGCCCCAGCTCAATCGCCGTCGGCCTGGCCAG
TCTGCAATAACGACGCCCCGCGACGAGAAGGATCTTGTCACCATACATTCTGGCACCGAGGCTGGCCGCACCCTG
GGCACTCCCATTCTCCTCACGGTCCCCAACCAAGACCAGCGGCCCCATGACTATGGCGACTCCACCATTGATCTT
TACCCGCGTCCCTCACACGCCGACTGGACTTATCTGGAAAAGTATGGCATCAAGGCTTCGTCGGGCGGCGGCAGA
TCTAGCGCCCGCGAAACGATTGCTCGCGTTGCTGCTGGCGCCGTCGCAGATAAATGGTTGCGCCAAACCTATGGC
GTCGAAATCGTTGCCTTTGTTTCCTCAGTTGGCTCGATCAAACTCTTTCCCGAGTCTCATGGCGAGCATGGCGCT
GATGCCCTGAGCTCCAATGCCCACTTTCTCAGCCTTGCCTCCTCCATTACTCGCGCCGAGGTGGACCAATTCCTC
CCAGTGCGTTGCCCCGACGCCGCTGCTGCTGCCGCCATGGAGAAGCGCATTGCCGAGCTGCGCGACCTGCACGAC
AGTACCGGCGGCACCGTCACATGCGTCATCCGCAACACACCTCCGGGCCTTGGCGAACCATGCTTTGACAAGCTT
GAGGCTTTGCTCGCCCATGCCATGCTCTCTATTCCTGCTGTCAAAGGCTTTGAAATCGGCTCCGGCTTCTGCGGC
GCCGAAATGACTGGCAGTAAACACAATGACCCTTTTGTACCCAGCGGCCAACCCACTGGTGTCACCCAAGTGGGC
GTCGATTCAGAGGCCGGTCTGCATACCCGCGCTACCCAGGCGGCTGGCATCCCAGCGTCGCGCCTTGCCACATCC
ACTAATCACTCTGGTGGCATTCAAGGCGGCATCTCCAACGGCATGCCTATCTTCTTCCGCGTTGCTTTTAAACCG
CCCGCAACCATCTCGCGCGACCAGACCACTGCGCGCTACGACGCCTCTGCTTCAGGTGTTCTTGCTGCCAAGGGC
CGTCACGATCCCTGCGTCGTCCCCCGTGCCGTGCCAATTGTAGAGGCCATGGCTGCTCTCACCATAGCTGACGCT
CTCATGGCTCAGCATGCCCGTGCTCAAGGCATTAGTGTCACGGCTAGCTGTCGAAACTAA
Transcript >OphauG2|359
ATGTCCACCTTTGGCCACCATTTCCGCATCACCACAGCCGGCGAGTCGCACGGTCGCTCCGTCTCGTGCATCATT
GACAATTGCCCTCCCGGCCTGGCTCTCACCGAAGCCGATATCCAGCCCCAGCTCAATCGCCGTCGGCCTGGCCAG
TCTGCAATAACGACGCCCCGCGACGAGAAGGATCTTGTCACCATACATTCTGGCACCGAGGCTGGCCGCACCCTG
GGCACTCCCATTCTCCTCACGGTCCCCAACCAAGACCAGCGGCCCCATGACTATGGCGACTCCACCATTGATCTT
TACCCGCGTCCCTCACACGCCGACTGGACTTATCTGGAAAAGTATGGCATCAAGGCTTCGTCGGGCGGCGGCAGA
TCTAGCGCCCGCGAAACGATTGCTCGCGTTGCTGCTGGCGCCGTCGCAGATAAATGGTTGCGCCAAACCTATGGC
GTCGAAATCGTTGCCTTTGTTTCCTCAGTTGGCTCGATCAAACTCTTTCCCGAGTCTCATGGCGAGCATGGCGCT
GATGCCCTGAGCTCCAATGCCCACTTTCTCAGCCTTGCCTCCTCCATTACTCGCGCCGAGGTGGACCAATTCCTC
CCAGTGCGTTGCCCCGACGCCGCTGCTGCTGCCGCCATGGAGAAGCGCATTGCCGAGCTGCGCGACCTGCACGAC
AGTACCGGCGGCACCGTCACATGCGTCATCCGCAACACACCTCCGGGCCTTGGCGAACCATGCTTTGACAAGCTT
GAGGCTTTGCTCGCCCATGCCATGCTCTCTATTCCTGCTGTCAAAGGCTTTGAAATCGGCTCCGGCTTCTGCGGC
GCCGAAATGACTGGCAGTAAACACAATGACCCTTTTGTACCCAGCGGCCAACCCACTGGTGTCACCCAAGTGGGC
GTCGATTCAGAGGCCGGTCTGCATACCCGCGCTACCCAGGCGGCTGGCATCCCAGCGTCGCGCCTTGCCACATCC
ACTAATCACTCTGGTGGCATTCAAGGCGGCATCTCCAACGGCATGCCTATCTTCTTCCGCGTTGCTTTTAAACCG
CCCGCAACCATCTCGCGCGACCAGACCACTGCGCGCTACGACGCCTCTGCTTCAGGTGTTCTTGCTGCCAAGGGC
CGTCACGATCCCTGCGTCGTCCCCCGTGCCGTGCCAATTGTAGAGGCCATGGCTGCTCTCACCATAGCTGACGCT
CTCATGGCTCAGCATGCCCGTGCTCAAGGCATTAGTGTCACGGCTAGCTGTCGAAACTAA
Gene >OphauG2|359
ATGTCCACCTTTGGCCACCATTTCCGCATCACCACGTAAGCTAATAGCCCAAGACACGTTGCAGAAACGCTTGCT
TACGTTTCCCAAGAGCCGGCGAGTCGCACGGTCGCTCCGTCTCGTGCATCATTGACAATTGCCCTCCCGGCCTGG
CTCTCACCGAAGCCGATATCCAGCCCCAGCTCAATCGCCGTCGGCCTGGCCAGTCTGCAATAACGACGCCCCGCG
ACGAGAAGGATCTTGTCACCATACATTCTGGCACCGAGGCTGGCCGCACCCTGGGCACTCCCATTCTCCTCACGG
TCCCCAACCAAGACCAGCGGCCCCATGACTATGGCGACTCCACCATTGATCTTTACCCGCGTCCCTCACACGCCG
ACTGGACTTATCTGGAAAAGTATGGCATCAAGGCTTCGTCGGGCGGCGGCAGATCTAGCGCCCGCGAAACGATTG
CTCGCGTTGCTGCTGGCGCCGTCGCAGATAAATGGTTGCGCCAAACCTATGGCGTCGAAATCGTTGCCTTTGTTT
CCTCAGTTGGCTCGATCAAACTCTTTCCCGAGTCTCATGGCGAGCATGGCGCTGATGCCCTGAGCTCCAATGCCC
ACTTTCTCAGCCTTGCCTCCTCCATTACTCGCGCCGAGGTGGACCAATTCCTCCCAGTGCGTTGCCCCGACGCCG
CTGCTGCTGCCGCCATGGAGAAGCGCATTGCCGAGCTGCGCGACCTGCACGACAGTACCGGCGGCACCGTCACAT
GCGTCATCCGCAACACACCTCCGGGCCTTGGCGAACCATGCTTTGACAAGCTTGAGGCTTTGCTCGCCCATGCCA
TGCTCTCTATTCCTGCTGTCAAAGGCTTTGAAATCGGCTCCGGCTTCTGCGGCGCCGAAATGACTGGCAGTAAAC
ACAATGACCCTTTTGTACCCAGCGGCCAACCCACTGGTGTCACCCAAGTGGGCGTCGATTCAGAGGCCGGTCTGC
ATACCCGCGCTACCCAGGCGGCTGGCATCCCAGCGTCGCGCCTTGCCACATCCACTAATCACTCTGGTGGCATTC
AAGGCGGCATCTCCAACGGCATGCCTATCTTCTTCCGCGTTGCTTTTAAACCGCCCGCAACCATCTCGCGCGACC
AGACCACTGCGCGCTACGACGCCTCTGCTTCAGGTGTTCTTGCTGCCAAGGGCCGTCACGATCCCTGCGTCGTCC
CCCGTGCCGTGCCAATTGTAGAGGCCATGGCTGCTCTCACCATAGCTGACGCTCTCATGGCTCAGCATGCCCGTG
CTCAAGGCATTAGTGTCACGGCTAGCTGTCGAAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail