Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3588
Gene name
LocationContig_277:4479..4737
Strand-
Gene length (bp)258
Transcript length (bp)258
Coding sequence length (bp)258
Protein length (aa) 86

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6109
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3588 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|3589
Ophiocordyceps australis map64 (Brazil) OphauB2|6953
Ophiocordyceps kimflemingae Ophio5|5697
Ophiocordyceps subramaniannii Hirsu2|3598

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3588
MKRKVLPKNMGGLRHIPFDGQDDDDDARSVRRHRVDLEGVPEKIRFDMAGKEGAQTEIELLPQTETQVLSPRKKL
LRGLSFKSNK*
Coding >OphauG2|3588
ATGAAGCGCAAGGTGCTTCCCAAGAACATGGGCGGCCTGCGCCACATCCCCTTTGACGGCCAGGACGATGACGAT
GATGCTCGCAGCGTCCGCCGCCACCGAGTCGACCTCGAGGGCGTTCCCGAGAAGATTCGCTTTGACATGGCTGGC
AAGGAGGGAGCCCAGACCGAGATTGAGCTTCTGCCCCAGACCGAGACCCAGGTTCTGTCCCCGCGCAAGAAGCTT
CTCCGAGGCCTCTCCTTCAAGAGCAACAAATAA
Transcript >OphauG2|3588
ATGAAGCGCAAGGTGCTTCCCAAGAACATGGGCGGCCTGCGCCACATCCCCTTTGACGGCCAGGACGATGACGAT
GATGCTCGCAGCGTCCGCCGCCACCGAGTCGACCTCGAGGGCGTTCCCGAGAAGATTCGCTTTGACATGGCTGGC
AAGGAGGGAGCCCAGACCGAGATTGAGCTTCTGCCCCAGACCGAGACCCAGGTTCTGTCCCCGCGCAAGAAGCTT
CTCCGAGGCCTCTCCTTCAAGAGCAACAAATAA
Gene >OphauG2|3588
ATGAAGCGCAAGGTGCTTCCCAAGAACATGGGCGGCCTGCGCCACATCCCCTTTGACGGCCAGGACGATGACGAT
GATGCTCGCAGCGTCCGCCGCCACCGAGTCGACCTCGAGGGCGTTCCCGAGAAGATTCGCTTTGACATGGCTGGC
AAGGAGGGAGCCCAGACCGAGATTGAGCTTCTGCCCCAGACCGAGACCCAGGTTCTGTCCCCGCGCAAGAAGCTT
CTCCGAGGCCTCTCCTTCAAGAGCAACAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail