Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3576
Gene name
LocationContig_275:17976..20634
Strand+
Gene length (bp)2658
Transcript length (bp)2658
Coding sequence length (bp)2658
Protein length (aa) 886

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00565 SNase Staphylococcal nuclease homologue 9.6E-05 33 141
PF00565 SNase Staphylococcal nuclease homologue 4.3E-14 198 304
PF00565 SNase Staphylococcal nuclease homologue 1.1E-15 343 452
PF00565 SNase Staphylococcal nuclease homologue 2.0E-21 510 615
PF00567 TUDOR Tudor domain 1.9E-22 643 769

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 884 2.0E-175
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 7 885 8.0E-129
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 7 885 2.0E-128
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 885 2.0E-127
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 885 3.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 884 2.0E-175
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 7 885 8.0E-129
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 7 885 2.0E-128
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 885 2.0E-127
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 885 3.0E-127
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 7 885 4.0E-127
sp|Q7ZT42|SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio GN=snd1 PE=2 SV=1 7 877 2.0E-119
sp|Q58EK5|TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio GN=tdrd1 PE=1 SV=2 673 766 7.0E-10
sp|Q9R1R4|TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus GN=Tdrd7 PE=1 SV=1 616 834 6.0E-09
sp|Q58EK5|TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio GN=tdrd1 PE=1 SV=2 651 842 2.0E-08
sp|Q8K1H1|TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus GN=Tdrd7 PE=1 SV=1 616 834 2.0E-08
sp|Q9BXT4|TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens GN=TDRD1 PE=1 SV=2 697 841 7.0E-08
sp|Q99MV1|TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus GN=Tdrd1 PE=1 SV=2 697 852 9.0E-08
sp|A9CPT4|TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes GN=tdrd1 PE=2 SV=1 673 753 3.0E-07
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 646 841 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3576
MSKSFVGNVKNVLSGDTLVLTSPNNLAMERIFSLAYVSAPHLRRDGDEPFAFQSREGLRALVVGKLVQCTILYTV
PTSGRDFGTVKVHDDLDLPDELVKAGWLKVREDAGRKEESEDIMERLQNLRSYETQAKSENKGLWAGTGGMIEVQ
NDLGGPDFLKEWKGKTVDGIVERVLSGDRLLVRLLLSDKKHVQPMTLLAGIRTPATERTLTSTGATQAAEEYGNE
ARQFVETRLLQRQIKVEVVGASAQGQLVANVIHPRGNIAEFLLQEGLARCNDFHSTMLGDKMARLRTAEKEAQAK
KLRLHKHHVAKVDGGNQETVVTKIIGADTILVRGKTGDAEKRINISSIRGPRAGDASESPFRDEAKEFLRQKLIG
KHIKISIDGTKPAADGFDAREVATVTEKGKNVGLMLVEAGWASVIRHRKDDTDRAPNYDELLAAQEKAKEDKKGM
WSGKPQKAKQYIDLSENAQKAKVMLATLQRQKKVPAIVDFCKAGSRFTILIPRENIKLTMVLGGIRAPRAPRQDG
QGGEPFGKEALEFTNRRCNQRDCEVDIHDMDKVGGFIGDLYINRDNFAKALVEEGLATVHAYSAEKSGNATELFA
AEKRAKESKKGVWHDYDASQEDNGFEEEATEAGKDVEVTLEKKPADYRDIVITNIDTNGKLKIQEIGKGTSALEA
LMGQFRQFHLDSKNSKALENAPKTGEFVSAKFSADGQWYRARVRANDRSAKMAEVLYIDYGNSEKVAWSSLRPLD
QTTFGTQKLKAQAVDASLSFVQLPTGADYFDDAIGFIAELTESKRLVGSFDFVDSKENVSYITLYDPKSNNELPG
PNDSINKEVVASGYGMVPKKLKAWERSKVFEGYLKHLREVESQAKQERRGMWEYGDITED*
Coding >OphauG2|3576
ATGTCCAAGTCATTTGTCGGCAATGTCAAAAATGTCCTCAGTGGCGACACATTGGTTCTTACAAGCCCCAACAAT
CTTGCCATGGAACGCATCTTCTCTCTCGCCTACGTGTCTGCCCCACACCTTAGGAGAGATGGCGACGAGCCCTTT
GCCTTCCAATCACGCGAGGGCTTGCGTGCTCTGGTGGTTGGCAAGCTAGTGCAATGTACAATCCTCTATACTGTT
CCCACGTCGGGGAGGGATTTTGGCACTGTCAAGGTTCACGATGACTTGGACCTCCCCGACGAGTTGGTCAAGGCT
GGCTGGCTCAAAGTGCGCGAAGATGCCGGCCGCAAAGAAGAATCCGAAGACATCATGGAAAGGCTGCAGAACCTC
CGATCCTATGAAACCCAGGCCAAGAGCGAGAACAAAGGATTGTGGGCTGGCACCGGTGGCATGATTGAGGTCCAG
AATGATCTCGGCGGGCCAGATTTTCTGAAGGAGTGGAAGGGCAAGACGGTTGATGGCATTGTCGAACGCGTTCTC
AGTGGCGATCGTCTACTCGTGCGACTTTTGCTCTCAGACAAGAAGCACGTACAGCCCATGACGCTGCTTGCCGGT
ATCCGCACTCCAGCAACTGAGAGAACTCTAACGTCTACTGGAGCTACCCAGGCTGCCGAAGAGTATGGCAACGAG
GCACGACAGTTTGTCGAGACGCGACTGCTCCAGCGCCAAATCAAGGTGGAGGTTGTAGGCGCCAGCGCACAGGGA
CAGCTAGTGGCCAATGTGATTCATCCTCGCGGCAACATTGCCGAGTTCTTGCTGCAAGAGGGCCTTGCCAGGTGC
AACGATTTCCACTCCACCATGCTTGGTGACAAGATGGCTCGTCTGCGGACAGCTGAAAAGGAAGCCCAGGCTAAG
AAGCTGCGTCTTCACAAGCATCATGTGGCCAAAGTTGACGGTGGCAACCAGGAAACAGTTGTCACCAAGATTATC
GGCGCTGACACCATTCTAGTCAGGGGCAAGACTGGAGATGCTGAAAAGAGGATCAACATTAGCAGTATTCGGGGA
CCTCGCGCAGGCGATGCTTCCGAGAGCCCATTTAGAGATGAAGCCAAGGAGTTTCTGCGCCAGAAGCTCATTGGC
AAACACATCAAGATTAGCATCGACGGAACCAAGCCTGCAGCAGATGGCTTCGACGCCCGCGAAGTGGCCACGGTG
ACAGAAAAGGGCAAGAATGTGGGCCTCATGCTTGTGGAGGCTGGGTGGGCGTCGGTTATTCGACACCGCAAGGAT
GACACTGACAGAGCCCCCAACTATGACGAGCTTCTTGCTGCCCAGGAAAAGGCCAAGGAGGACAAGAAGGGAATG
TGGTCTGGCAAGCCCCAAAAGGCCAAACAATACATCGACTTGTCTGAAAATGCGCAAAAGGCAAAGGTTATGCTG
GCGACACTTCAACGACAGAAAAAGGTGCCGGCCATTGTCGACTTTTGCAAAGCTGGCTCCCGCTTCACAATTCTC
ATTCCACGTGAGAACATCAAGCTCACCATGGTTCTTGGTGGCATTCGAGCTCCTCGCGCCCCTCGACAAGACGGC
CAAGGCGGTGAGCCGTTTGGAAAGGAGGCGCTTGAATTTACCAATCGCAGATGCAACCAACGCGATTGTGAAGTT
GACATACATGACATGGACAAGGTGGGTGGGTTTATCGGCGACCTATACATCAACCGGGACAATTTTGCCAAGGCG
CTCGTCGAGGAGGGTCTTGCGACGGTTCATGCATACTCGGCGGAGAAGTCTGGAAATGCAACTGAATTGTTTGCC
GCGGAGAAGCGGGCCAAGGAGAGCAAAAAGGGTGTCTGGCATGACTACGATGCGTCGCAAGAAGACAATGGCTTC
GAGGAGGAAGCCACAGAGGCTGGAAAAGACGTGGAGGTGACTCTGGAAAAGAAGCCGGCGGATTATCGCGATATT
GTCATTACAAACATTGACACCAATGGCAAGCTCAAAATCCAAGAGATTGGCAAGGGCACATCGGCTCTCGAGGCG
CTCATGGGCCAGTTCCGGCAATTCCACCTCGACTCCAAGAACAGCAAGGCGCTGGAGAATGCGCCCAAGACTGGA
GAGTTTGTGTCGGCCAAGTTTTCTGCCGATGGGCAGTGGTATCGGGCGCGGGTGCGTGCCAATGACCGCAGCGCC
AAGATGGCCGAGGTTTTGTACATTGACTACGGCAACAGTGAAAAGGTGGCATGGTCGAGTCTCAGGCCGCTGGAC
CAGACAACTTTTGGCACGCAGAAGCTCAAGGCGCAGGCTGTGGATGCCTCGCTGTCCTTTGTACAGCTGCCTACA
GGAGCGGATTACTTTGATGATGCCATTGGCTTTATTGCAGAGTTGACTGAGAGCAAGCGGCTAGTGGGCAGCTTC
GACTTTGTTGACAGCAAGGAGAACGTCAGCTACATTACGCTCTACGATCCAAAGTCGAACAATGAGCTGCCGGGG
CCAAATGACTCAATAAACAAGGAGGTGGTGGCCAGTGGGTACGGAATGGTGCCAAAGAAGCTCAAGGCGTGGGAA
CGAAGCAAGGTGTTTGAAGGCTATCTCAAGCACCTGCGTGAGGTGGAGAGCCAAGCCAAACAGGAGCGACGAGGC
ATGTGGGAGTATGGAGACATTACTGAGGACTAG
Transcript >OphauG2|3576
ATGTCCAAGTCATTTGTCGGCAATGTCAAAAATGTCCTCAGTGGCGACACATTGGTTCTTACAAGCCCCAACAAT
CTTGCCATGGAACGCATCTTCTCTCTCGCCTACGTGTCTGCCCCACACCTTAGGAGAGATGGCGACGAGCCCTTT
GCCTTCCAATCACGCGAGGGCTTGCGTGCTCTGGTGGTTGGCAAGCTAGTGCAATGTACAATCCTCTATACTGTT
CCCACGTCGGGGAGGGATTTTGGCACTGTCAAGGTTCACGATGACTTGGACCTCCCCGACGAGTTGGTCAAGGCT
GGCTGGCTCAAAGTGCGCGAAGATGCCGGCCGCAAAGAAGAATCCGAAGACATCATGGAAAGGCTGCAGAACCTC
CGATCCTATGAAACCCAGGCCAAGAGCGAGAACAAAGGATTGTGGGCTGGCACCGGTGGCATGATTGAGGTCCAG
AATGATCTCGGCGGGCCAGATTTTCTGAAGGAGTGGAAGGGCAAGACGGTTGATGGCATTGTCGAACGCGTTCTC
AGTGGCGATCGTCTACTCGTGCGACTTTTGCTCTCAGACAAGAAGCACGTACAGCCCATGACGCTGCTTGCCGGT
ATCCGCACTCCAGCAACTGAGAGAACTCTAACGTCTACTGGAGCTACCCAGGCTGCCGAAGAGTATGGCAACGAG
GCACGACAGTTTGTCGAGACGCGACTGCTCCAGCGCCAAATCAAGGTGGAGGTTGTAGGCGCCAGCGCACAGGGA
CAGCTAGTGGCCAATGTGATTCATCCTCGCGGCAACATTGCCGAGTTCTTGCTGCAAGAGGGCCTTGCCAGGTGC
AACGATTTCCACTCCACCATGCTTGGTGACAAGATGGCTCGTCTGCGGACAGCTGAAAAGGAAGCCCAGGCTAAG
AAGCTGCGTCTTCACAAGCATCATGTGGCCAAAGTTGACGGTGGCAACCAGGAAACAGTTGTCACCAAGATTATC
GGCGCTGACACCATTCTAGTCAGGGGCAAGACTGGAGATGCTGAAAAGAGGATCAACATTAGCAGTATTCGGGGA
CCTCGCGCAGGCGATGCTTCCGAGAGCCCATTTAGAGATGAAGCCAAGGAGTTTCTGCGCCAGAAGCTCATTGGC
AAACACATCAAGATTAGCATCGACGGAACCAAGCCTGCAGCAGATGGCTTCGACGCCCGCGAAGTGGCCACGGTG
ACAGAAAAGGGCAAGAATGTGGGCCTCATGCTTGTGGAGGCTGGGTGGGCGTCGGTTATTCGACACCGCAAGGAT
GACACTGACAGAGCCCCCAACTATGACGAGCTTCTTGCTGCCCAGGAAAAGGCCAAGGAGGACAAGAAGGGAATG
TGGTCTGGCAAGCCCCAAAAGGCCAAACAATACATCGACTTGTCTGAAAATGCGCAAAAGGCAAAGGTTATGCTG
GCGACACTTCAACGACAGAAAAAGGTGCCGGCCATTGTCGACTTTTGCAAAGCTGGCTCCCGCTTCACAATTCTC
ATTCCACGTGAGAACATCAAGCTCACCATGGTTCTTGGTGGCATTCGAGCTCCTCGCGCCCCTCGACAAGACGGC
CAAGGCGGTGAGCCGTTTGGAAAGGAGGCGCTTGAATTTACCAATCGCAGATGCAACCAACGCGATTGTGAAGTT
GACATACATGACATGGACAAGGTGGGTGGGTTTATCGGCGACCTATACATCAACCGGGACAATTTTGCCAAGGCG
CTCGTCGAGGAGGGTCTTGCGACGGTTCATGCATACTCGGCGGAGAAGTCTGGAAATGCAACTGAATTGTTTGCC
GCGGAGAAGCGGGCCAAGGAGAGCAAAAAGGGTGTCTGGCATGACTACGATGCGTCGCAAGAAGACAATGGCTTC
GAGGAGGAAGCCACAGAGGCTGGAAAAGACGTGGAGGTGACTCTGGAAAAGAAGCCGGCGGATTATCGCGATATT
GTCATTACAAACATTGACACCAATGGCAAGCTCAAAATCCAAGAGATTGGCAAGGGCACATCGGCTCTCGAGGCG
CTCATGGGCCAGTTCCGGCAATTCCACCTCGACTCCAAGAACAGCAAGGCGCTGGAGAATGCGCCCAAGACTGGA
GAGTTTGTGTCGGCCAAGTTTTCTGCCGATGGGCAGTGGTATCGGGCGCGGGTGCGTGCCAATGACCGCAGCGCC
AAGATGGCCGAGGTTTTGTACATTGACTACGGCAACAGTGAAAAGGTGGCATGGTCGAGTCTCAGGCCGCTGGAC
CAGACAACTTTTGGCACGCAGAAGCTCAAGGCGCAGGCTGTGGATGCCTCGCTGTCCTTTGTACAGCTGCCTACA
GGAGCGGATTACTTTGATGATGCCATTGGCTTTATTGCAGAGTTGACTGAGAGCAAGCGGCTAGTGGGCAGCTTC
GACTTTGTTGACAGCAAGGAGAACGTCAGCTACATTACGCTCTACGATCCAAAGTCGAACAATGAGCTGCCGGGG
CCAAATGACTCAATAAACAAGGAGGTGGTGGCCAGTGGGTACGGAATGGTGCCAAAGAAGCTCAAGGCGTGGGAA
CGAAGCAAGGTGTTTGAAGGCTATCTCAAGCACCTGCGTGAGGTGGAGAGCCAAGCCAAACAGGAGCGACGAGGC
ATGTGGGAGTATGGAGACATTACTGAGGACTAG
Gene >OphauG2|3576
ATGTCCAAGTCATTTGTCGGCAATGTCAAAAATGTCCTCAGTGGCGACACATTGGTTCTTACAAGCCCCAACAAT
CTTGCCATGGAACGCATCTTCTCTCTCGCCTACGTGTCTGCCCCACACCTTAGGAGAGATGGCGACGAGCCCTTT
GCCTTCCAATCACGCGAGGGCTTGCGTGCTCTGGTGGTTGGCAAGCTAGTGCAATGTACAATCCTCTATACTGTT
CCCACGTCGGGGAGGGATTTTGGCACTGTCAAGGTTCACGATGACTTGGACCTCCCCGACGAGTTGGTCAAGGCT
GGCTGGCTCAAAGTGCGCGAAGATGCCGGCCGCAAAGAAGAATCCGAAGACATCATGGAAAGGCTGCAGAACCTC
CGATCCTATGAAACCCAGGCCAAGAGCGAGAACAAAGGATTGTGGGCTGGCACCGGTGGCATGATTGAGGTCCAG
AATGATCTCGGCGGGCCAGATTTTCTGAAGGAGTGGAAGGGCAAGACGGTTGATGGCATTGTCGAACGCGTTCTC
AGTGGCGATCGTCTACTCGTGCGACTTTTGCTCTCAGACAAGAAGCACGTACAGCCCATGACGCTGCTTGCCGGT
ATCCGCACTCCAGCAACTGAGAGAACTCTAACGTCTACTGGAGCTACCCAGGCTGCCGAAGAGTATGGCAACGAG
GCACGACAGTTTGTCGAGACGCGACTGCTCCAGCGCCAAATCAAGGTGGAGGTTGTAGGCGCCAGCGCACAGGGA
CAGCTAGTGGCCAATGTGATTCATCCTCGCGGCAACATTGCCGAGTTCTTGCTGCAAGAGGGCCTTGCCAGGTGC
AACGATTTCCACTCCACCATGCTTGGTGACAAGATGGCTCGTCTGCGGACAGCTGAAAAGGAAGCCCAGGCTAAG
AAGCTGCGTCTTCACAAGCATCATGTGGCCAAAGTTGACGGTGGCAACCAGGAAACAGTTGTCACCAAGATTATC
GGCGCTGACACCATTCTAGTCAGGGGCAAGACTGGAGATGCTGAAAAGAGGATCAACATTAGCAGTATTCGGGGA
CCTCGCGCAGGCGATGCTTCCGAGAGCCCATTTAGAGATGAAGCCAAGGAGTTTCTGCGCCAGAAGCTCATTGGC
AAACACATCAAGATTAGCATCGACGGAACCAAGCCTGCAGCAGATGGCTTCGACGCCCGCGAAGTGGCCACGGTG
ACAGAAAAGGGCAAGAATGTGGGCCTCATGCTTGTGGAGGCTGGGTGGGCGTCGGTTATTCGACACCGCAAGGAT
GACACTGACAGAGCCCCCAACTATGACGAGCTTCTTGCTGCCCAGGAAAAGGCCAAGGAGGACAAGAAGGGAATG
TGGTCTGGCAAGCCCCAAAAGGCCAAACAATACATCGACTTGTCTGAAAATGCGCAAAAGGCAAAGGTTATGCTG
GCGACACTTCAACGACAGAAAAAGGTGCCGGCCATTGTCGACTTTTGCAAAGCTGGCTCCCGCTTCACAATTCTC
ATTCCACGTGAGAACATCAAGCTCACCATGGTTCTTGGTGGCATTCGAGCTCCTCGCGCCCCTCGACAAGACGGC
CAAGGCGGTGAGCCGTTTGGAAAGGAGGCGCTTGAATTTACCAATCGCAGATGCAACCAACGCGATTGTGAAGTT
GACATACATGACATGGACAAGGTGGGTGGGTTTATCGGCGACCTATACATCAACCGGGACAATTTTGCCAAGGCG
CTCGTCGAGGAGGGTCTTGCGACGGTTCATGCATACTCGGCGGAGAAGTCTGGAAATGCAACTGAATTGTTTGCC
GCGGAGAAGCGGGCCAAGGAGAGCAAAAAGGGTGTCTGGCATGACTACGATGCGTCGCAAGAAGACAATGGCTTC
GAGGAGGAAGCCACAGAGGCTGGAAAAGACGTGGAGGTGACTCTGGAAAAGAAGCCGGCGGATTATCGCGATATT
GTCATTACAAACATTGACACCAATGGCAAGCTCAAAATCCAAGAGATTGGCAAGGGCACATCGGCTCTCGAGGCG
CTCATGGGCCAGTTCCGGCAATTCCACCTCGACTCCAAGAACAGCAAGGCGCTGGAGAATGCGCCCAAGACTGGA
GAGTTTGTGTCGGCCAAGTTTTCTGCCGATGGGCAGTGGTATCGGGCGCGGGTGCGTGCCAATGACCGCAGCGCC
AAGATGGCCGAGGTTTTGTACATTGACTACGGCAACAGTGAAAAGGTGGCATGGTCGAGTCTCAGGCCGCTGGAC
CAGACAACTTTTGGCACGCAGAAGCTCAAGGCGCAGGCTGTGGATGCCTCGCTGTCCTTTGTACAGCTGCCTACA
GGAGCGGATTACTTTGATGATGCCATTGGCTTTATTGCAGAGTTGACTGAGAGCAAGCGGCTAGTGGGCAGCTTC
GACTTTGTTGACAGCAAGGAGAACGTCAGCTACATTACGCTCTACGATCCAAAGTCGAACAATGAGCTGCCGGGG
CCAAATGACTCAATAAACAAGGAGGTGGTGGCCAGTGGGTACGGAATGGTGCCAAAGAAGCTCAAGGCGTGGGAA
CGAAGCAAGGTGTTTGAAGGCTATCTCAAGCACCTGCGTGAGGTGGAGAGCCAAGCCAAACAGGAGCGACGAGGC
ATGTGGGAGTATGGAGACATTACTGAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail