Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3558
Gene name
LocationContig_273:9884..10659
Strand-
Gene length (bp)775
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10187 FAM192A_Fyv6_N FAM192A/Fyv6, N-terminal domain 7.9E-28 32 129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q91WE2|F192A_MOUSE Protein FAM192A OS=Mus musculus GN=Fam192a PE=1 SV=1 37 110 3.0E-07
sp|Q9GZU8|F192A_HUMAN Protein FAM192A OS=Homo sapiens GN=FAM192A PE=1 SV=1 65 110 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1609
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3558 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5472
Ophiocordyceps camponoti-floridani Ophcf2|04660
Ophiocordyceps camponoti-rufipedis Ophun1|2747
Ophiocordyceps kimflemingae Ophio5|4255
Ophiocordyceps subramaniannii Hirsu2|1260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3558
MASRFVGGGTIGAESAAETDKQQSQPPAAAAGSKSVEWEVVQRQLEEERRRKDEARIKAATGGERSLYEILQANK
AAKQEAFEEQHRLRNQFRALDDDEAAFLDEVRERQAQKENALRQETEQGLREFREKQRQGASGGALEENEASEDW
GVSRKRKRAVRTTGANKVTRRSGEKTVDKQEAVDKGRETTRSQTTGKETSRVSALVAYGSDDSDDA*
Coding >OphauG2|3558
ATGGCGAGCCGCTTCGTGGGCGGCGGGACAATAGGCGCCGAAAGCGCGGCAGAGACAGACAAGCAGCAGAGCCAA
CCACCAGCAGCGGCAGCCGGGAGCAAGAGTGTCGAGTGGGAGGTTGTACAGCGACAGCTGGAAGAGGAGCGGCGA
CGGAAAGACGAAGCTCGAATCAAGGCAGCCACAGGAGGGGAACGGTCACTGTATGAGATTCTGCAGGCAAACAAG
GCGGCCAAACAAGAAGCCTTTGAGGAACAGCACCGGCTGCGCAACCAGTTTCGTGCGCTGGATGATGACGAGGCA
GCATTTCTGGATGAGGTGCGGGAGCGACAGGCGCAGAAGGAGAATGCACTGCGGCAAGAGACGGAGCAGGGACTG
CGCGAGTTTCGCGAAAAACAGCGCCAAGGGGCCAGCGGTGGCGCGCTTGAGGAGAATGAGGCCAGTGAGGACTGG
GGCGTGAGCCGGAAAAGGAAGCGGGCTGTGAGGACAACGGGAGCCAACAAGGTGACAAGGAGGAGTGGCGAAAAG
ACTGTGGACAAGCAAGAGGCTGTAGACAAAGGGAGAGAAACGACGAGGAGCCAGACGACGGGCAAGGAGACAAGC
CGCGTGTCGGCATTAGTAGCGTATGGTTCTGACGACAGTGACGATGCATGA
Transcript >OphauG2|3558
ATGGCGAGCCGCTTCGTGGGCGGCGGGACAATAGGCGCCGAAAGCGCGGCAGAGACAGACAAGCAGCAGAGCCAA
CCACCAGCAGCGGCAGCCGGGAGCAAGAGTGTCGAGTGGGAGGTTGTACAGCGACAGCTGGAAGAGGAGCGGCGA
CGGAAAGACGAAGCTCGAATCAAGGCAGCCACAGGAGGGGAACGGTCACTGTATGAGATTCTGCAGGCAAACAAG
GCGGCCAAACAAGAAGCCTTTGAGGAACAGCACCGGCTGCGCAACCAGTTTCGTGCGCTGGATGATGACGAGGCA
GCATTTCTGGATGAGGTGCGGGAGCGACAGGCGCAGAAGGAGAATGCACTGCGGCAAGAGACGGAGCAGGGACTG
CGCGAGTTTCGCGAAAAACAGCGCCAAGGGGCCAGCGGTGGCGCGCTTGAGGAGAATGAGGCCAGTGAGGACTGG
GGCGTGAGCCGGAAAAGGAAGCGGGCTGTGAGGACAACGGGAGCCAACAAGGTGACAAGGAGGAGTGGCGAAAAG
ACTGTGGACAAGCAAGAGGCTGTAGACAAAGGGAGAGAAACGACGAGGAGCCAGACGACGGGCAAGGAGACAAGC
CGCGTGTCGGCATTAGTAGCGTATGGTTCTGACGACAGTGACGATGCATGA
Gene >OphauG2|3558
ATGGCGAGCCGCTTCGTGGGCGGCGGGACAATAGGCGCCGAAAGCGCGGCAGAGACAGACAAGCAGCAGAGCCAA
CCACCAGCAGCGGCAGCCGGGAGCAAGAGTGTCGAGTGGGAGGTTGTACAGCGACAGCTGGAAGAGGAGCGGCGA
CGGAAAGACGAAGCTCGAATCAAGGCAGCCACAGGAGGGGAACGGTCACTGTATGAGATTCTGCAGGCAAACAAG
GGTGCGTCTCTTGTTTTATCGTGGGCACCATATATATATATATATATGCCTGTCTAGTGTTTCTGCTGGCTGGCT
GGCTGGATGGCTGGATGGCACAGCCATGGGCTGACGTGACAAGGACGCAGCGGCCAAACAAGAAGCCTTTGAGGA
ACAGCACCGGCTGCGCAACCAGTTTCGTGCGCTGGATGATGACGAGGCAGCATTTCTGGATGAGGTGCGGGAGCG
ACAGGCGCAGAAGGAGAATGCACTGCGGCAAGAGACGGAGCAGGGACTGCGCGAGTTTCGCGAAAAACAGCGCCA
AGGGGCCAGCGGTGGCGCGCTTGAGGAGAATGAGGCCAGTGAGGACTGGGGCGTGAGCCGGAAAAGGAAGCGGGC
TGTGAGGACAACGGGAGCCAACAAGGTGACAAGGAGGAGTGGCGAAAAGACTGTGGACAAGCAAGAGGCTGTAGA
CAAAGGGAGAGAAACGACGAGGAGCCAGACGACGGGCAAGGAGACAAGCCGCGTGTCGGCATTAGTAGCGTATGG
TTCTGACGACAGTGACGATGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail