Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3552
Gene name
LocationContig_273:77..1827
Strand-
Gene length (bp)1750
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 8.3E-12 317 408
PF08701 GN3L_Grn1 GNL3L/Grn1 putative GTPase 1.8E-11 19 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 9 546 8.0E-129
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 10 541 1.0E-119
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 194 541 5.0E-51
sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=Ns1 PE=1 SV=2 168 505 2.0E-49
sp|Q9M8Z5|NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana GN=NSN1 PE=2 SV=1 146 557 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 9 546 8.0E-129
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 10 541 1.0E-119
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 194 541 5.0E-51
sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=Ns1 PE=1 SV=2 168 505 2.0E-49
sp|Q9M8Z5|NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana GN=NSN1 PE=2 SV=1 146 557 3.0E-46
sp|Q54KS4|GNL3_DICDI Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum GN=gnl3 PE=3 SV=1 188 530 7.0E-46
sp|Q9NVN8|GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens GN=GNL3L PE=1 SV=1 185 548 1.0E-44
sp|Q6PGG6|GNL3L_MOUSE Guanine nucleotide-binding protein-like 3-like protein OS=Mus musculus GN=Gnl3l PE=1 SV=1 185 548 1.0E-43
sp|Q3T0J9|GNL3L_BOVIN Guanine nucleotide-binding protein-like 3-like protein OS=Bos taurus GN=GNL3L PE=2 SV=1 185 548 1.0E-43
sp|Q9C923|NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana GN=NUG2 PE=1 SV=1 187 505 1.0E-39
sp|Q10LF7|NUG2_ORYSJ Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. japonica GN=NUG2 PE=1 SV=1 187 525 2.0E-39
sp|A2XGQ1|NUG2_ORYSI Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. indica GN=NUG2 PE=3 SV=1 187 525 2.0E-39
sp|Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens GN=GNL3 PE=1 SV=2 188 504 8.0E-38
sp|Q99LH1|NOG2_MOUSE Nucleolar GTP-binding protein 2 OS=Mus musculus GN=Gnl2 PE=1 SV=2 144 509 3.0E-37
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens GN=GNL2 PE=1 SV=1 144 535 8.0E-37
sp|Q7SHR8|NOG2_NEUCR Nucleolar GTP-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nog-2 PE=3 SV=1 153 519 2.0E-36
sp|O14236|NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog2 PE=1 SV=1 158 553 3.0E-36
sp|Q75DA4|NOG2_ASHGO Nucleolar GTP-binding protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOG2 PE=3 SV=1 147 503 5.0E-36
sp|Q6FWS1|NOG2_CANGA Nucleolar GTP-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOG2 PE=3 SV=1 168 503 6.0E-36
sp|Q6C036|NOG2_YARLI Nucleolar GTP-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOG2 PE=3 SV=1 187 517 6.0E-36
sp|Q6CSP9|NOG2_KLULA Nucleolar GTP-binding protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOG2 PE=3 SV=1 144 503 6.0E-35
sp|P53742|NOG2_YEAST Nucleolar GTP-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOG2 PE=1 SV=1 168 500 5.0E-34
sp|Q8CI11|GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus GN=Gnl3 PE=1 SV=2 188 504 1.0E-33
sp|J9VQ03|NOG2_CRYNH Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=NOG2 PE=3 SV=2 185 539 2.0E-32
sp|P0CS94|NOG2_CRYNV Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii GN=NOG2 PE=3 SV=1 185 539 2.0E-32
sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2 OS=Pneumocystis carinii GN=NOG2 PE=2 SV=1 145 502 1.0E-31
sp|Q6P4W5|GNL3_XENTR Guanine nucleotide-binding protein-like 3 OS=Xenopus tropicalis GN=gnl3 PE=2 SV=2 202 506 7.0E-31
sp|Q811S9|GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus GN=Gnl3 PE=1 SV=1 188 504 1.0E-30
sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 192 503 5.0E-30
sp|Q6TGJ8|NOG2_CRYGA Nucleolar GTP-binding protein 2 OS=Cryptococcus gattii GN=NOG2 PE=3 SV=1 185 504 9.0E-30
sp|Q7ZX41|GNL3_XENLA Guanine nucleotide-binding protein-like 3 OS=Xenopus laevis GN=gnl3 PE=2 SV=1 202 507 8.0E-26
sp|Q58859|Y1464_METJA Uncharacterized GTP-binding protein MJ1464 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1464 PE=3 SV=1 198 499 3.0E-21
sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 202 531 8.0E-20
sp|Q9SHS8|LSG11_ARATH GTPase LSG1-1 OS=Arabidopsis thaliana GN=LSG1-1 PE=1 SV=1 202 505 2.0E-19
sp|Q9SJF1|LSG12_ARATH GTPase LSG1-2 OS=Arabidopsis thaliana GN=LSG1-2 PE=1 SV=1 202 511 2.0E-18
sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 198 519 5.0E-18
sp|A8FD69|RBGA_BACP2 Ribosome biogenesis GTPase A OS=Bacillus pumilus (strain SAFR-032) GN=rbgA PE=3 SV=1 208 492 3.0E-14
sp|Q9W590|LSG1_DROME Large subunit GTPase 1 homolog OS=Drosophila melanogaster GN=Ns3 PE=1 SV=1 305 506 4.0E-14
sp|Q8H1F6|DGP3_ARATH DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana GN=DGP3 PE=2 SV=1 197 507 1.0E-13
sp|Q9WZM6|RBGA_THEMA Ribosome biogenesis GTPase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbgA PE=1 SV=1 201 495 3.0E-13
sp|Q29AU5|MTG1_DROPS Mitochondrial GTPase 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14342 PE=3 SV=2 200 385 4.0E-13
sp|Q65JP4|RBGA_BACLD Ribosome biogenesis GTPase A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbgA PE=3 SV=1 208 492 8.0E-13
sp|D5DJL5|RBGA_BACMD Ribosome biogenesis GTPase A OS=Bacillus megaterium (strain DSM 319) GN=rbgA PE=3 SV=1 201 382 3.0E-12
sp|B7GGD6|RBGA_ANOFW Ribosome biogenesis GTPase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rbgA PE=3 SV=1 208 496 4.0E-12
sp|Q5BJT6|LSG1_RAT Large subunit GTPase 1 homolog OS=Rattus norvegicus GN=Lsg1 PE=2 SV=1 280 525 4.0E-11
sp|Q9VCU5|MTG1_DROME Mitochondrial ribosome-associated GTPase 1 OS=Drosophila melanogaster GN=CG17141 PE=1 SV=2 200 383 6.0E-11
sp|E0TTS5|RBGA_BACPZ Ribosome biogenesis GTPase A OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=rbgA PE=3 SV=1 208 492 6.0E-11
sp|O31743|RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) GN=rbgA PE=1 SV=1 208 492 9.0E-11
sp|Q6NY89|LSG1_DANRE Large subunit GTPase 1 homolog OS=Danio rerio GN=lsg1 PE=2 SV=1 277 505 1.0E-10
sp|Q5ZJD3|LSG1_CHICK Large subunit GTPase 1 homolog OS=Gallus gallus GN=LSG1 PE=2 SV=1 280 505 2.0E-10
sp|Q3UM18|LSG1_MOUSE Large subunit GTPase 1 homolog OS=Mus musculus GN=Lsg1 PE=1 SV=2 278 522 2.0E-10
sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens GN=LSG1 PE=1 SV=2 285 503 3.0E-10
sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus GN=LSG1 PE=2 SV=1 298 503 5.0E-10
sp|Q7YR35|GNL1_PANTR Guanine nucleotide-binding protein-like 1 OS=Pan troglodytes GN=GNL1 PE=3 SV=3 65 528 5.0E-10
sp|Q5TM59|GNL1_MACMU Guanine nucleotide-binding protein-like 1 OS=Macaca mulatta GN=GNL1 PE=3 SV=1 65 528 6.0E-10
sp|Q4R8D2|GNL1_MACFA Guanine nucleotide-binding protein-like 1 OS=Macaca fascicularis GN=GNL1 PE=2 SV=1 65 528 6.0E-10
sp|Q5RA07|GNL1_PONAB Guanine nucleotide-binding protein-like 1 OS=Pongo abelii GN=GNL1 PE=2 SV=1 65 528 7.0E-10
sp|C5D8U8|RBGA_GEOSW Ribosome biogenesis GTPase A OS=Geobacillus sp. (strain WCH70) GN=rbgA PE=3 SV=1 208 496 8.0E-10
sp|Q819W8|RBGA_BACCR Ribosome biogenesis GTPase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbgA PE=3 SV=1 201 496 3.0E-09
sp|Q17EJ1|MTG1_AEDAE Mitochondrial GTPase 1 OS=Aedes aegypti GN=AAEL003813 PE=3 SV=1 198 401 2.0E-08
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 194 500 2.0E-08
sp|Q4R8L2|LSG1_MACFA Large subunit GTPase 1 homolog OS=Macaca fascicularis GN=LSG1 PE=2 SV=1 285 503 2.0E-08
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 198 496 1.0E-07
sp|Q8L607|SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana GN=SIN2 PE=1 SV=1 207 391 1.0E-07
sp|Q8SUT1|GNL3L_ENCCU Guanine nucleotide-binding protein-like 3-like protein OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0330 PE=1 SV=2 202 265 3.0E-07
sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 OS=Homo sapiens GN=GNL1 PE=1 SV=2 314 528 8.0E-07
sp|Q49435|RBGA_MYCGE Probable ribosome biogenesis GTPase A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rbgA PE=3 SV=1 298 495 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3552 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5467
Ophiocordyceps camponoti-floridani Ophcf2|04656
Ophiocordyceps camponoti-rufipedis Ophun1|2743
Ophiocordyceps kimflemingae Ophio5|4251
Ophiocordyceps subramaniannii Hirsu2|8752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3552
MAGTINKPKKPTSKRGTSRLRHKIEKKAAAKQRKQRKLAKNNPEWRSRMKKDPGVLSGFAHRMMESKDGSLETRR
IALARQLTKRTQSDTARAGHDAHGSVEHGEQQKDAEAEALSSDADESHHGSDNDMDMDMDGDVDESNPMAALLAS
ARSAAARYNGELERDHAMADDDGDDNDASCCHEAPAFGQSLSRKTYDKVFKQVVEQADVVLYVLDARDPQGTRSR
EVERSVMAAASGGKRLILIVNKMDLVPPKVLRGWLVHLRRYFPTLPLRAAGAAANATTFNHGELTAQKTAASLFG
ALKAFAATRQLKRAVSVGVIGYPNVGKSSVINALLGRMSTKGRGAKAKPCPAGAEAGVTTSIRCVKIDSKLTLLD
SPGVVFPSSSSLSGNLVALDNALDAHAHLVLLNAVPPKQINDAMPAVSLLIRRLSLSPDLMRKLTEFYDIPPLLP
DGGDGDVTTDFLVQVARKRGRLGRGGVPNVNAAAMTVVTDWRDGRIQGWVEPPALPLESGPVAANKGEEEVMADQ
KEIVTEWAAEFKLEGLWGGKDDEGGSEQGMQESRTG*
Coding >OphauG2|3552
ATGGCTGGTACCATCAATAAACCAAAGAAGCCCACGTCGAAGCGCGGCACCAGTCGCCTTCGCCACAAGATCGAG
AAAAAGGCAGCAGCCAAGCAGAGGAAACAACGCAAATTGGCCAAAAACAACCCCGAGTGGAGGTCCAGGATGAAA
AAGGATCCGGGCGTCTTGTCAGGTTTTGCCCATAGAATGATGGAGTCCAAGGACGGAAGCTTGGAAACGCGCAGA
ATAGCACTGGCTCGGCAGCTGACCAAGAGGACTCAGTCGGACACTGCCCGGGCTGGCCATGACGCCCACGGCTCA
GTAGAGCATGGCGAGCAACAAAAGGACGCCGAGGCCGAGGCATTGAGCAGCGACGCTGACGAGAGCCACCATGGA
AGCGACAATGACATGGACATGGACATGGACGGCGACGTCGATGAGTCTAATCCCATGGCTGCGCTCTTGGCCAGC
GCCAGGAGTGCAGCAGCACGGTACAATGGGGAACTCGAAAGGGACCATGCCATGGCAGATGACGACGGCGACGAC
AATGACGCCTCTTGTTGCCACGAAGCCCCGGCTTTTGGACAGAGCTTGTCGCGGAAAACCTACGACAAGGTATTC
AAACAAGTCGTCGAGCAGGCCGACGTTGTTCTCTACGTGCTAGACGCGCGGGACCCCCAAGGCACGCGCAGCCGC
GAGGTGGAGCGCAGCGTCATGGCGGCAGCATCGGGTGGCAAGCGCCTCATTCTCATTGTCAACAAGATGGACCTG
GTGCCGCCAAAGGTGCTGCGCGGCTGGCTTGTACATCTGCGTCGCTATTTTCCTACCCTGCCGCTGCGCGCCGCA
GGCGCAGCCGCAAATGCCACGACTTTTAACCATGGCGAATTGACGGCGCAAAAAACGGCGGCTTCGCTCTTTGGC
GCTCTCAAAGCATTTGCGGCAACAAGACAGCTCAAGCGAGCCGTGTCGGTGGGTGTCATTGGATATCCCAACGTG
GGCAAAAGCTCCGTCATCAATGCCCTGCTGGGTAGGATGAGCACCAAGGGCCGAGGCGCAAAGGCCAAGCCGTGT
CCCGCCGGCGCCGAGGCGGGCGTCACGACGAGCATTCGCTGCGTCAAGATTGACAGCAAGCTGACCCTGCTTGAC
TCGCCCGGGGTCGTCTTCCCCTCGTCGTCGTCGTTGTCTGGAAACCTTGTTGCCCTTGACAATGCCCTTGACGCC
CATGCTCATCTTGTCCTCCTCAACGCCGTGCCGCCCAAGCAGATCAACGACGCCATGCCCGCCGTCAGTCTCCTG
ATTCGCCGTCTGTCCCTGTCGCCTGATTTGATGCGCAAACTGACCGAGTTTTACGACATTCCCCCCCTGCTTCCC
GACGGTGGCGACGGTGACGTGACGACTGACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGC
GGCGTGCCCAATGTAAATGCTGCGGCCATGACGGTTGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTC
GAGCCTCCCGCTCTGCCCCTGGAGTCGGGTCCCGTTGCCGCAAACAAGGGAGAGGAAGAAGTCATGGCGGACCAA
AAGGAAATAGTCACCGAATGGGCAGCCGAGTTTAAGCTCGAGGGGCTGTGGGGCGGCAAGGACGACGAGGGTGGC
TCGGAACAAGGCATGCAGGAATCAAGGACAGGATGA
Transcript >OphauG2|3552
ATGGCTGGTACCATCAATAAACCAAAGAAGCCCACGTCGAAGCGCGGCACCAGTCGCCTTCGCCACAAGATCGAG
AAAAAGGCAGCAGCCAAGCAGAGGAAACAACGCAAATTGGCCAAAAACAACCCCGAGTGGAGGTCCAGGATGAAA
AAGGATCCGGGCGTCTTGTCAGGTTTTGCCCATAGAATGATGGAGTCCAAGGACGGAAGCTTGGAAACGCGCAGA
ATAGCACTGGCTCGGCAGCTGACCAAGAGGACTCAGTCGGACACTGCCCGGGCTGGCCATGACGCCCACGGCTCA
GTAGAGCATGGCGAGCAACAAAAGGACGCCGAGGCCGAGGCATTGAGCAGCGACGCTGACGAGAGCCACCATGGA
AGCGACAATGACATGGACATGGACATGGACGGCGACGTCGATGAGTCTAATCCCATGGCTGCGCTCTTGGCCAGC
GCCAGGAGTGCAGCAGCACGGTACAATGGGGAACTCGAAAGGGACCATGCCATGGCAGATGACGACGGCGACGAC
AATGACGCCTCTTGTTGCCACGAAGCCCCGGCTTTTGGACAGAGCTTGTCGCGGAAAACCTACGACAAGGTATTC
AAACAAGTCGTCGAGCAGGCCGACGTTGTTCTCTACGTGCTAGACGCGCGGGACCCCCAAGGCACGCGCAGCCGC
GAGGTGGAGCGCAGCGTCATGGCGGCAGCATCGGGTGGCAAGCGCCTCATTCTCATTGTCAACAAGATGGACCTG
GTGCCGCCAAAGGTGCTGCGCGGCTGGCTTGTACATCTGCGTCGCTATTTTCCTACCCTGCCGCTGCGCGCCGCA
GGCGCAGCCGCAAATGCCACGACTTTTAACCATGGCGAATTGACGGCGCAAAAAACGGCGGCTTCGCTCTTTGGC
GCTCTCAAAGCATTTGCGGCAACAAGACAGCTCAAGCGAGCCGTGTCGGTGGGTGTCATTGGATATCCCAACGTG
GGCAAAAGCTCCGTCATCAATGCCCTGCTGGGTAGGATGAGCACCAAGGGCCGAGGCGCAAAGGCCAAGCCGTGT
CCCGCCGGCGCCGAGGCGGGCGTCACGACGAGCATTCGCTGCGTCAAGATTGACAGCAAGCTGACCCTGCTTGAC
TCGCCCGGGGTCGTCTTCCCCTCGTCGTCGTCGTTGTCTGGAAACCTTGTTGCCCTTGACAATGCCCTTGACGCC
CATGCTCATCTTGTCCTCCTCAACGCCGTGCCGCCCAAGCAGATCAACGACGCCATGCCCGCCGTCAGTCTCCTG
ATTCGCCGTCTGTCCCTGTCGCCTGATTTGATGCGCAAACTGACCGAGTTTTACGACATTCCCCCCCTGCTTCCC
GACGGTGGCGACGGTGACGTGACGACTGACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGC
GGCGTGCCCAATGTAAATGCTGCGGCCATGACGGTTGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTC
GAGCCTCCCGCTCTGCCCCTGGAGTCGGGTCCCGTTGCCGCAAACAAGGGAGAGGAAGAAGTCATGGCGGACCAA
AAGGAAATAGTCACCGAATGGGCAGCCGAGTTTAAGCTCGAGGGGCTGTGGGGCGGCAAGGACGACGAGGGTGGC
TCGGAACAAGGCATGCAGGAATCAAGGACAGGATGA
Gene >OphauG2|3552
ATGGCTGGTACCATCAATAAACCAAAGAGTATGCTTTGCTTCTGCACATGATTGTAAAGGCAAGCAGCGGCCCTG
GCTGACTCTTGACGCAGAGCCCACGTCGAAGCGCGGCACCAGTCGCCTTCGCCACAAGATCGAGAAAAAGGCAGC
AGCCAAGCAGAGGAAACAACGCAAATTGGCCAAAAACAACCCCGAGTGGAGGTCCAGGATGAAAAAGGATCCGGG
CGTCTTGTCAGGTTTTGCCCATAGAATGATGGAGTCCAAGGACGGAAGCTTGGAAACGCGCAGAATAGCACTGGC
TCGGCAGCTGACCAAGAGGACTCAGTCGGACACTGCCCGGGCTGGCCATGACGCCCACGGCTCAGTAGAGCATGG
CGAGCAACAAAAGGACGCCGAGGCCGAGGCATTGAGCAGCGACGCTGACGAGAGCCACCATGGAAGCGACAATGA
CATGGACATGGACATGGACGGCGACGTCGATGAGTCTAATCCCATGGCTGCGCTCTTGGCCAGCGCCAGGAGTGC
AGCAGCACGGTACAATGGGGAACTCGAAAGGGACCATGCCATGGCAGATGACGACGGCGACGACAATGACGCCTC
TTGTTGCCACGAAGCCCCGGCTTTTGGACAGAGCTTGTCGCGGAAAACCTACGACAAGGTATTCAAACAAGTCGT
CGAGCAGGCCGACGTTGTTCTCTACGTGCTAGACGCGCGGGACCCCCAAGGCACGCGCAGCCGCGAGGTGGAGCG
CAGCGTCATGGCGGCAGCATCGGGTGGCAAGCGCCTCATTCTCATTGTCAACAAGATGGACCTGGTGCCGCCAAA
GGTGCTGCGCGGCTGGCTTGTACATCTGCGTCGCTATTTTCCTACCCTGCCGCTGCGCGCCGCAGGCGCAGCCGC
AAATGCCACGACTTTTAACCATGGCGAATTGACGGCGCAAAAAACGGCGGCTTCGCTCTTTGGCGCTCTCAAAGC
ATTTGCGGCAACAAGACAGCTCAAGCGAGCCGTGTCGGTGGGTGTCATTGGATATCCCAACGTGGGCAAAAGCTC
CGTCATCAATGCCCTGCTGGGTAGGATGAGCACCAAGGGCCGAGGCGCAAAGGCCAAGCCGTGTCCCGCCGGCGC
CGAGGCGGGCGTCACGACGAGCATTCGCTGCGTCAAGATTGACAGCAAGCTGACCCTGCTTGACTCGCCCGGGGT
CGTCTTCCCCTCGTCGTCGTCGTTGTCTGGAAACCTTGTTGCCCTTGACAATGCCCTTGACGCCCATGCTCATCT
TGTCCTCCTCAACGCCGTGCCGCCCAAGCAGATCAACGACGCCATGCCCGCCGTCAGTCTCCTGATTCGCCGTCT
GTCCCTGTCGCCTGATTTGATGCGCAAACTGACCGAGTTTTACGACATTCCCCCCCTGCTTCCCGACGGTGGCGA
CGGTGACGTGACGACTGACTTTCTCGTCCAGGTGGCGCGCAAGCGTGGCCGTTTGGGACGTGGCGGCGTGCCCAA
TGTAAATGCTGCGGCCATGACGGTTGTTACAGATTGGCGCGACGGCCGCATCCAGGGCTGGGTCGAGCCTCCCGC
TCTGCCCCTGGAGTCGGGTCCCGTTGCCGCAAACAAGGGAGAGGAAGAAGTCATGGCGGACCAAAAGGAAATAGT
CACCGAATGGGCAGCCGAGTTTAAGCTCGAGGGGCTGTGGGGCGGCAAGGACGACGAGGGTGGCTCGGAACAAGG
CATGCAGGAATCAAGGACAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail