Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3549
Gene name
LocationContig_272:3006..5031
Strand-
Gene length (bp)2025
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 1.2E-16 118 184
PF09011 HMG_box_2 HMG-box domain 1.3E-13 116 183
PF00536 SAM_1 SAM domain (Sterile alpha motif) 2.9E-10 11 58
PF07647 SAM_2 SAM domain (Sterile alpha motif) 1.7E-07 11 59

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKF4|HM20A_CHICK High mobility group protein 20A OS=Gallus gallus GN=HMG20A PE=2 SV=1 101 214 2.0E-13
sp|Q9DC33|HM20A_MOUSE High mobility group protein 20A OS=Mus musculus GN=Hmg20a PE=1 SV=1 101 198 3.0E-13
sp|Q9NP66|HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens GN=HMG20A PE=1 SV=1 101 198 3.0E-13
sp|Q6DIJ5|HM20A_XENTR High mobility group protein 20A OS=Xenopus tropicalis GN=hmg20a PE=2 SV=1 101 193 7.0E-12
sp|Q6AZF8|HM20A_XENLA High mobility group protein 20A OS=Xenopus laevis GN=hmg20a PE=2 SV=1 105 193 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKF4|HM20A_CHICK High mobility group protein 20A OS=Gallus gallus GN=HMG20A PE=2 SV=1 101 214 2.0E-13
sp|Q9DC33|HM20A_MOUSE High mobility group protein 20A OS=Mus musculus GN=Hmg20a PE=1 SV=1 101 198 3.0E-13
sp|Q9NP66|HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens GN=HMG20A PE=1 SV=1 101 198 3.0E-13
sp|Q6DIJ5|HM20A_XENTR High mobility group protein 20A OS=Xenopus tropicalis GN=hmg20a PE=2 SV=1 101 193 7.0E-12
sp|Q6AZF8|HM20A_XENLA High mobility group protein 20A OS=Xenopus laevis GN=hmg20a PE=2 SV=1 105 193 2.0E-11
sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens GN=HMGB3 PE=1 SV=4 114 189 5.0E-11
sp|Q32L31|HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2 114 189 6.0E-11
sp|P40618|HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus GN=HMGB3 PE=2 SV=3 114 189 7.0E-11
sp|O54879|HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus GN=Hmgb3 PE=1 SV=3 114 189 8.0E-11
sp|P11632|NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6A PE=1 SV=1 114 186 6.0E-10
sp|O04235|SSRP1_VICFA FACT complex subunit SSRP1 OS=Vicia faba GN=SSRP1 PE=2 SV=1 114 184 8.0E-10
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 112 184 1.0E-09
sp|P11633|NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 98 186 2.0E-09
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 108 183 2.0E-09
sp|Q9YH06|HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus GN=HMGB1 PE=1 SV=1 78 184 3.0E-09
sp|P07746|HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss PE=2 SV=2 80 184 5.0E-09
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 103 183 6.0E-09
sp|Q6BRB4|NHP6_DEBHA Non-histone chromosomal protein 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NHP6 PE=3 SV=1 114 185 6.0E-09
sp|P40673|HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus GN=HMGB2 PE=1 SV=3 116 184 9.0E-09
sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens GN=HMGB2 PE=1 SV=2 116 184 9.0E-09
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 109 183 9.0E-09
sp|P52925|HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus GN=Hmgb2 PE=2 SV=2 116 184 1.0E-08
sp|P17741|HMGB2_PIG High mobility group protein B2 OS=Sus scrofa GN=HMGB2 PE=1 SV=2 116 184 1.0E-08
sp|Q4R844|HMGB1_MACFA High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3 66 184 2.0E-08
sp|P87057|NHP6_SCHPO Non-histone chromosomal protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhp6 PE=3 SV=1 112 183 2.0E-08
sp|P10103|HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus GN=HMGB1 PE=1 SV=3 66 184 2.0E-08
sp|B0CM99|HMGB1_CALJA High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1 66 184 2.0E-08
sp|B1MTB0|HMGB1_CALMO High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1 66 184 2.0E-08
sp|Q6YKA4|HMGB1_CANLF High mobility group protein B1 OS=Canis lupus familiaris GN=HMGB1 PE=2 SV=3 66 184 2.0E-08
sp|Q08IE6|HMGB1_HORSE High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3 66 184 2.0E-08
sp|P09429|HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3 66 184 2.0E-08
sp|P63158|HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2 66 184 2.0E-08
sp|A9RA84|HMGB1_PAPAN High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1 66 184 2.0E-08
sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2 66 184 2.0E-08
sp|P26584|HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus GN=HMGB2 PE=2 SV=2 114 187 2.0E-08
sp|Q80W03|TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus GN=Tox3 PE=2 SV=1 35 184 2.0E-08
sp|Q9UVL1|NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 114 188 3.0E-08
sp|P07156|HMGB1_CRIGR High mobility group protein B1 (Fragment) OS=Cricetulus griseus GN=HMGB1 PE=1 SV=1 78 184 3.0E-08
sp|P12682|HMGB1_PIG High mobility group protein B1 OS=Sus scrofa GN=HMGB1 PE=2 SV=3 66 184 4.0E-08
sp|P0CO25|NHP6_CRYNB Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NHP6 PE=3 SV=1 108 183 4.0E-08
sp|Q32L68|HM20B_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Bos taurus GN=HMG20B PE=2 SV=1 101 189 4.0E-08
sp|P0CO24|NHP6_CRYNJ Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NHP6 PE=3 SV=1 108 183 4.0E-08
sp|Q9Z104|HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus GN=Hmg20b PE=1 SV=1 81 189 5.0E-08
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 105 186 6.0E-08
sp|P30681|HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus GN=Hmgb2 PE=1 SV=3 116 184 7.0E-08
sp|Q4H2R2|SSRP1_CIOIN FACT complex subunit SSRP1 OS=Ciona intestinalis GN=SSRP1 PE=2 SV=1 101 184 7.0E-08
sp|Q5R6A9|TOX4_PONAB TOX high mobility group box family member 4 OS=Pongo abelii GN=TOX4 PE=2 SV=2 114 184 2.0E-07
sp|O94842|TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens GN=TOX4 PE=1 SV=1 114 184 2.0E-07
sp|B7SBD2|TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus GN=Tox3 PE=1 SV=1 35 184 2.0E-07
sp|Q9P0W2|HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens GN=HMG20B PE=1 SV=1 101 189 2.0E-07
sp|Q6CC79|NHP6_YARLI Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 114 187 3.0E-07
sp|Q0P5K4|TOX4_BOVIN TOX high mobility group box family member 4 OS=Bos taurus GN=TOX4 PE=2 SV=1 114 184 3.0E-07
sp|Q8BU11|TOX4_MOUSE TOX high mobility group box family member 4 OS=Mus musculus GN=Tox4 PE=1 SV=3 114 184 3.0E-07
sp|Q99PM1|TOX4_RAT TOX high mobility group box family member 4 OS=Rattus norvegicus GN=Tox4 PE=1 SV=1 114 184 3.0E-07
sp|O15405|TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens GN=TOX3 PE=1 SV=2 114 184 3.0E-07
sp|Q75B82|NHP6_ASHGO Non-histone chromosomal protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NHP6 PE=3 SV=1 114 186 4.0E-07
sp|Q6IRR0|TOX4B_XENLA TOX high mobility group box family member 4-B OS=Xenopus laevis GN=tox4-b PE=2 SV=1 114 184 5.0E-07
sp|A4QNP0|TOX4_XENTR TOX high mobility group box family member 4 OS=Xenopus tropicalis GN=tox4 PE=2 SV=1 114 184 5.0E-07
sp|Q6DJL0|TOX4A_XENLA TOX high mobility group box family member 4-A OS=Xenopus laevis GN=tox4-a PE=2 SV=1 114 184 6.0E-07
sp|Q04678|SSRP1_CHICK FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2 114 183 6.0E-07
sp|Q9USU7|YHHB_SCHPO HMG box-containing protein C28F2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC28F2.11 PE=1 SV=1 88 198 8.0E-07
sp|Q08943|SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2 114 184 9.0E-07
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 99 190 1.0E-06
sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 102 183 1.0E-06
sp|Q76IQ7|TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus GN=Tox2 PE=2 SV=1 114 186 1.0E-06
sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1 105 184 1.0E-06
sp|P40623|HMG1B_CHITE Mobility group protein 1B OS=Chironomus tentans GN=HMG1B PE=3 SV=1 116 186 1.0E-06
sp|Q04931|SSRP1_RAT FACT complex subunit SSRP1 OS=Rattus norvegicus GN=Ssrp1 PE=1 SV=2 114 184 1.0E-06
sp|P26586|HMGL_TRYBR High mobility group protein homolog TDP-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 112 181 2.0E-06
sp|B2RPK0|HGB1A_HUMAN Putative high mobility group protein B1-like 1 OS=Homo sapiens GN=HMGB1P1 PE=5 SV=1 49 183 4.0E-06
sp|Q4PBZ9|NHP6_USTMA Non-histone chromosomal protein 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NHP6 PE=3 SV=2 112 170 5.0E-06
sp|P40622|HMG1A_CHITE Mobility group protein 1A OS=Chironomus tentans GN=HMG1A PE=3 SV=1 118 186 8.0E-06
sp|Q9SUP7|HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana GN=HMGB6 PE=2 SV=1 118 186 8.0E-06
sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 114 185 8.0E-06
sp|Q9T012|HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana GN=HMGB13 PE=2 SV=1 118 186 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3549 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1703
Ophiocordyceps camponoti-floridani Ophcf2|07148
Ophiocordyceps camponoti-rufipedis Ophun1|6040
Ophiocordyceps kimflemingae Ophio5|2278
Ophiocordyceps subramaniannii Hirsu2|10186

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3549
MTRELEGIFAELGLSQYLDAFVDQGFDAWETILDIQESDLDALGVKLGHRRKLQRRIANARGIAPSVSLATTAKV
ASEQSKQESLRHDTSRAIDGIAEPNGITKRKYRRHPKPDENAPERPPSAYVLFSNKMREDLKSQSLTFTEIAKLV
GENWQSLPPAEKETYECQANAAKEKYHRDLAEYKKTSNFAKYAAYLHDFKEKQAKQTRDSSKRPKLEPPRLRHGS
TSSGATPGGATSAGSRSGSSSERLQGSEPPPTRQERMHSSASMAPTQPSSTAVTPISVSHTNSMDETTSPRCAMF
EGSSPRDAHQRPSRRQMSWASRQRGNSSSVHQHLPSLSDMLEDGAGKSADTTDSAAHGFSAAVSGSLRPVSDVAP
VLPPARVPRLHHQPSSCSTMTSRSSTGSMGRPLGEGPLPIHALLTDRAVPSRSPVDFELQAIPSMAAVVTSPSGK
RNPALGQIHGPKGYGFQSESSVFQNMKVERSGEGDVLMTTVDTVASPSSRRKEGLDGMSALLRAGEIVGRHNQG*
Coding >OphauG2|3549
ATGACTCGAGAACTTGAAGGCATCTTTGCAGAGTTGGGGTTGTCCCAATATCTAGATGCCTTTGTCGACCAGGGG
TTTGACGCTTGGGAGACCATTCTTGACATTCAAGAATCAGATCTTGATGCATTAGGTGTGAAGCTAGGCCATCGA
CGGAAGCTGCAAAGGCGCATTGCCAATGCCCGGGGAATAGCTCCGAGCGTTTCATTGGCGACAACGGCCAAGGTG
GCCTCGGAGCAGTCCAAGCAAGAATCGCTTCGGCACGACACGAGTCGCGCCATTGATGGCATTGCTGAGCCCAAT
GGCATTACTAAGCGAAAGTATCGTCGGCATCCCAAGCCGGATGAGAATGCGCCAGAGCGGCCGCCTTCGGCCTAC
GTGCTTTTCTCCAATAAAATGAGAGAAGATTTAAAAAGCCAGAGCCTCACCTTTACAGAAATAGCAAAACTGGTG
GGTGAGAATTGGCAGAGTTTGCCGCCGGCAGAGAAGGAGACGTATGAGTGTCAGGCGAATGCGGCCAAGGAAAAA
TACCATCGCGACCTGGCCGAGTACAAGAAGACGAGCAACTTTGCCAAATACGCGGCCTATCTGCACGACTTCAAA
GAGAAGCAAGCAAAGCAAACCAGAGATTCATCCAAGAGACCCAAGCTGGAGCCGCCGAGGCTGCGGCACGGGAGC
ACCAGCAGTGGGGCAACTCCGGGAGGAGCAACGTCGGCCGGCAGCCGAAGCGGCAGCAGCAGCGAGAGACTGCAG
GGCAGTGAGCCTCCACCAACGCGCCAAGAGCGCATGCACTCGTCGGCGTCCATGGCGCCGACGCAGCCATCGTCG
ACGGCGGTGACGCCCATTTCTGTCTCTCACACAAACTCGATGGACGAGACGACGTCGCCGCGGTGCGCCATGTTT
GAAGGGTCGAGCCCACGCGATGCGCACCAGCGGCCGTCGCGGCGGCAGATGTCTTGGGCCAGCCGGCAGCGAGGC
AACTCGAGCTCGGTCCACCAGCATTTGCCGTCGCTGTCGGACATGCTGGAAGACGGCGCGGGCAAGAGCGCTGAC
ACGACTGATTCTGCGGCGCACGGCTTCTCGGCAGCAGTCTCGGGCTCTCTGAGGCCTGTCTCAGACGTGGCGCCC
GTCTTGCCTCCAGCACGTGTTCCCAGGCTGCACCACCAGCCCTCATCGTGCAGCACCATGACGTCGCGGAGCTCG
ACAGGCAGCATGGGACGGCCTCTGGGCGAGGGCCCTCTGCCCATCCACGCACTGCTCACAGACCGCGCAGTGCCG
AGCCGAAGCCCTGTCGACTTTGAGTTGCAGGCGATTCCAAGCATGGCGGCTGTTGTCACAAGCCCCAGTGGGAAG
AGAAACCCAGCCCTGGGACAGATCCATGGGCCCAAGGGCTATGGCTTCCAATCCGAGTCATCAGTCTTTCAAAAC
ATGAAGGTGGAACGGTCTGGAGAGGGTGATGTGCTGATGACAACAGTTGACACCGTGGCCTCGCCCAGCAGCCGA
CGCAAGGAAGGCCTCGATGGCATGAGTGCGCTGCTGCGGGCCGGTGAAATCGTTGGTCGGCATAATCAGGGCTAA
Transcript >OphauG2|3549
ATGACTCGAGAACTTGAAGGCATCTTTGCAGAGTTGGGGTTGTCCCAATATCTAGATGCCTTTGTCGACCAGGGG
TTTGACGCTTGGGAGACCATTCTTGACATTCAAGAATCAGATCTTGATGCATTAGGTGTGAAGCTAGGCCATCGA
CGGAAGCTGCAAAGGCGCATTGCCAATGCCCGGGGAATAGCTCCGAGCGTTTCATTGGCGACAACGGCCAAGGTG
GCCTCGGAGCAGTCCAAGCAAGAATCGCTTCGGCACGACACGAGTCGCGCCATTGATGGCATTGCTGAGCCCAAT
GGCATTACTAAGCGAAAGTATCGTCGGCATCCCAAGCCGGATGAGAATGCGCCAGAGCGGCCGCCTTCGGCCTAC
GTGCTTTTCTCCAATAAAATGAGAGAAGATTTAAAAAGCCAGAGCCTCACCTTTACAGAAATAGCAAAACTGGTG
GGTGAGAATTGGCAGAGTTTGCCGCCGGCAGAGAAGGAGACGTATGAGTGTCAGGCGAATGCGGCCAAGGAAAAA
TACCATCGCGACCTGGCCGAGTACAAGAAGACGAGCAACTTTGCCAAATACGCGGCCTATCTGCACGACTTCAAA
GAGAAGCAAGCAAAGCAAACCAGAGATTCATCCAAGAGACCCAAGCTGGAGCCGCCGAGGCTGCGGCACGGGAGC
ACCAGCAGTGGGGCAACTCCGGGAGGAGCAACGTCGGCCGGCAGCCGAAGCGGCAGCAGCAGCGAGAGACTGCAG
GGCAGTGAGCCTCCACCAACGCGCCAAGAGCGCATGCACTCGTCGGCGTCCATGGCGCCGACGCAGCCATCGTCG
ACGGCGGTGACGCCCATTTCTGTCTCTCACACAAACTCGATGGACGAGACGACGTCGCCGCGGTGCGCCATGTTT
GAAGGGTCGAGCCCACGCGATGCGCACCAGCGGCCGTCGCGGCGGCAGATGTCTTGGGCCAGCCGGCAGCGAGGC
AACTCGAGCTCGGTCCACCAGCATTTGCCGTCGCTGTCGGACATGCTGGAAGACGGCGCGGGCAAGAGCGCTGAC
ACGACTGATTCTGCGGCGCACGGCTTCTCGGCAGCAGTCTCGGGCTCTCTGAGGCCTGTCTCAGACGTGGCGCCC
GTCTTGCCTCCAGCACGTGTTCCCAGGCTGCACCACCAGCCCTCATCGTGCAGCACCATGACGTCGCGGAGCTCG
ACAGGCAGCATGGGACGGCCTCTGGGCGAGGGCCCTCTGCCCATCCACGCACTGCTCACAGACCGCGCAGTGCCG
AGCCGAAGCCCTGTCGACTTTGAGTTGCAGGCGATTCCAAGCATGGCGGCTGTTGTCACAAGCCCCAGTGGGAAG
AGAAACCCAGCCCTGGGACAGATCCATGGGCCCAAGGGCTATGGCTTCCAATCCGAGTCATCAGTCTTTCAAAAC
ATGAAGGTGGAACGGTCTGGAGAGGGTGATGTGCTGATGACAACAGTTGACACCGTGGCCTCGCCCAGCAGCCGA
CGCAAGGAAGGCCTCGATGGCATGAGTGCGCTGCTGCGGGCCGGTGAAATCGTTGGTCGGCATAATCAGGGCTAA
Gene >OphauG2|3549
ATGACTCGAGAACTTGAAGGCATCTTTGCAGAGTTGGGGTTGTCCCAATATCTAGATGCCTTTGTCGACCAGGGG
TTTGACGCTTGGGAGACCATTCTTGACATTCAAGAATCAGATCTGTAGGTTGATGCTTGGCTATTTGCTTGTAAT
GTGGAGTCATATTGACTAACGACTGCCTTGAATATAGTGATGCATTAGGTGTGAAGCTAGGCCATCGACGGGTAT
GTCTTGACTTGTTTTGCCGTTAGTTTTGTCAAGCTGATGCTCATTATGCCTGTTCAGAAGCTGCAAAGGCGCATT
GCCAATGCCCGGGGAATAGCTCCGAGCGTTTCATTGGCGACAACGGCCAAGGTGGCCTCGGAGCAGTCCAAGCAA
GAATCGCTTCGGCACGACACGAGTCGCGCCATTGATGGCATTGCTGAGCCCAATGGCATTACTAAGCGAAAGTAT
CGTCGGCATCCCAAGGTTTGTCAAAGCCGTGGTTCAGGCGCAACTTTGCTGTCTTGATTATGGACTGATTTGGTT
GAATAATTGTAGCCGGATGAGAATGCGCCAGAGCGGCCGCCTTCGGCCTACGTGCTTTTCTCCAATAGTAAGCCT
TTTTATACTCGACTTGGACGCGAGGAAAGACAGAGAACAAAATTCAAGATTTGATTTTTTTTACCCTTGTATCAA
GGATTCGACTGATTGGTTGGCTGACTGGGCCTTTGCAGAAATGAGAGAAGATTTAAAAAGCCAGAGCCTCACCTT
TACAGAAATAGCAAAACTGGTGGGTGAGAATTGGCAGAGTTTGCCGCCGGCAGAGAAGGAGACGTATGAGTGTCA
GGCGAATGCGGCCAAGGAAAAATACCATCGCGACCTGGCCGAGTACAAGAAGACGAGCAACTTTGCCAAATACGC
GGCCTATCTGCACGACTTCAAAGAGAAGCAAGCAAAGCAAACCAGAGGTTGGTGCAACCGAGTCAGCAGGCGCTG
TTGCATTGGTTCACTGTGGCTGACATGGCAGACCAAGATTCATCCAAGAGACCCAAGCTGGAGCCGCCGAGGCTG
CGGCACGGGAGCACCAGCAGTGGGGCAACTCCGGGAGGAGCAACGTCGGCCGGCAGCCGAAGCGGCAGCAGCAGC
GAGAGACTGCAGGGCAGTGAGCCTCCACCAACGCGCCAAGAGCGCATGCACTCGTCGGCGTCCATGGCGCCGACG
CAGCCATCGTCGACGGCGGTGACGCCCATTTCTGTCTCTCACACAAACTCGATGGACGAGACGACGTCGCCGCGG
TGCGCCATGTTTGAAGGGTCGAGCCCACGCGATGCGCACCAGCGGCCGTCGCGGCGGCAGATGTCTTGGGCCAGC
CGGCAGCGAGGCAACTCGAGCTCGGTCCACCAGCATTTGCCGTCGCTGTCGGACATGCTGGAAGACGGCGCGGGC
AAGAGCGCTGACACGACTGATTCTGCGGCGCACGGCTTCTCGGCAGCAGTCTCGGGCTCTCTGAGGCCTGTCTCA
GACGTGGCGCCCGTCTTGCCTCCAGCACGTGTTCCCAGGCTGCACCACCAGCCCTCATCGTGCAGCACCATGACG
TCGCGGAGCTCGACAGGCAGCATGGGACGGCCTCTGGGCGAGGGCCCTCTGCCCATCCACGCACTGCTCACAGAC
CGCGCAGTGCCGAGCCGAAGCCCTGTCGACTTTGAGTTGCAGGCGATTCCAAGCATGGCGGCTGTTGTCACAAGC
CCCAGTGGGAAGAGAAACCCAGCCCTGGGACAGATCCATGGGCCCAAGGGCTATGGTACTTATACCTTCCCTTCT
CATTGAATCCATCGACGCGGTGGCTAATTGTCGGCATTGTAAGGCTTCCAATCCGAGTCATCAGTCTTTCAAAAC
ATGAAGGTGGAACGGTCTGGAGAGGGTGATGTGCTGATGACAACAGTTGACACCGTGGCCTCGCCCAGCAGCCGA
CGCAAGGAAGGCCTCGATGGCATGAGTGCGCTGCTGCGGGCCGGTGAAATCGTTGGTCGGCATAATCAGGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail