Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3543
Gene name
LocationContig_271:9979..12503
Strand-
Gene length (bp)2524
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19834 DUF6314 Family of unknown function (DUF6314) 2.6E-30 619 782
PF13454 NAD_binding_9 FAD-NAD(P)-binding 6.7E-11 7 147
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.3E-07 7 58
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.5E-09 3 219
PF00743 FMO-like Flavin-binding monooxygenase-like 6.5E-07 2 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 30 201 2.0E-11
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 1 206 4.0E-08
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 3 193 4.0E-08
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 201 1.0E-07
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 2 238 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 30 201 2.0E-11
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 1 206 4.0E-08
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 3 193 4.0E-08
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 201 1.0E-07
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 2 238 2.0E-07
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 1 206 4.0E-07
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 1 206 2.0E-06
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 2 228 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1643
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3543 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1086
Ophiocordyceps camponoti-floridani Ophcf2|03619
Ophiocordyceps camponoti-rufipedis Ophun1|6143
Ophiocordyceps kimflemingae Ophio5|17
Ophiocordyceps subramaniannii Hirsu2|1335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3543
MAKSVCIVGAGPSGVVAAKTLLHNAPGGAFRVSVFEAQSSVGGLWPSKADDSQGRPIDGLMMCNQSQHTMHFSDM
AWEADTGQMPRAWQVGRYIERYVQRHLEGQPGFTLRLSTRVVKADKRDGGWEIETERGERERFEYLVVASGYFGE
ARIADEVKAASVPVVHSSAYTGLGKLLEGREVSPEAKILVVGGQLSGLEVAAAVARDISTARYGERESRLNNVET
LSVEHIVQKPAWVIPLYTCPKPEGAAPAFLPLDCCSYNLANRSVPLENTQGHVSVEAARRMHGVFEAVVGTDQSE
FGMRIGDEERDEVPYLGVSDVYADFVRSGMISVVKGRLGSVGADKAASDDAAKKAEDNDEQCPRPTTATAVLSSG
MEIPNVAAIISATGFDAAPSLGFLSASVLDKLGFAPDHGAQVLALGMHGTLHPNVARLGFVGFYRAPYWGVMQMQ
ARLLAAVWSLNEEQEARRAEGKERTKRVKEDTAAANETDTEVYKANKETMMEKGDEQEEKETAQNQLSKALSADD
SITRTLALRNDTRLAQFPMGDYPWLMQQLSAALSIPLVPISGPLNTLCPARYPCPSDDSVAQGQAATSRAKLSQT
ISCGLSTPRFIPRAVFRSLLGKWNLQRSVRSRSASHPSGEFSGIATFYLRDTWPLESSLGFEYVYREEGKFCAAD
SRLEFEASRSYVWRYDEARNIVSVWFVRTDGDGTRAVTDYLFHELEFGAPAQEGKGWSAVATHLCVEDWYNMAYE
FVFCAVNLRSWSVQYTVSGPKKDYSIKGTYTR*
Coding >OphauG2|3543
ATGGCCAAGTCTGTTTGCATTGTCGGAGCGGGACCGTCGGGAGTCGTGGCGGCCAAGACGCTTCTGCACAATGCC
CCGGGCGGAGCTTTTCGCGTCAGTGTGTTTGAGGCACAGAGCAGCGTGGGCGGCCTGTGGCCCAGCAAAGCCGAC
GACAGTCAAGGACGGCCCATTGACGGGCTAATGATGTGTAACCAGAGCCAGCACACCATGCATTTTAGCGACATG
GCGTGGGAGGCGGACACGGGGCAGATGCCGCGGGCGTGGCAGGTTGGACGGTATATTGAGCGCTATGTGCAGCGG
CATCTTGAAGGACAGCCAGGCTTTACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGACAAGAGAGATGGCGGG
TGGGAGATTGAGACGGAAAGGGGCGAGAGGGAGAGGTTTGAGTACTTAGTCGTTGCGTCGGGATACTTTGGAGAA
GCGCGCATTGCGGATGAGGTCAAGGCGGCCTCGGTGCCCGTGGTGCATAGTAGTGCGTACACGGGCCTGGGCAAG
CTGCTAGAGGGGAGAGAGGTGAGTCCAGAGGCAAAGATCTTGGTGGTTGGAGGGCAGTTGTCGGGGCTGGAGGTT
GCGGCGGCCGTGGCGAGGGATATATCGACGGCAAGGTATGGGGAGAGGGAGAGCCGGCTCAACAATGTCGAGACG
CTGAGCGTTGAGCACATTGTGCAAAAGCCAGCATGGGTGATTCCGCTCTATACATGTCCCAAGCCTGAAGGAGCA
GCGCCGGCGTTTTTACCGCTGGATTGCTGTTCGTACAACTTGGCGAATAGAAGTGTCCCTTTGGAGAATACGCAG
GGACATGTAAGTGTTGAAGCAGCGCGGAGAATGCATGGCGTATTCGAGGCCGTCGTGGGGACTGACCAGAGTGAG
TTTGGCATGCGTATTGGAGATGAGGAGAGGGACGAGGTGCCGTATTTGGGGGTGAGTGATGTGTATGCCGATTTT
GTGCGGAGCGGTATGATTTCAGTCGTCAAGGGAAGGCTTGGTTCGGTAGGGGCAGACAAGGCGGCTTCAGACGAC
GCTGCAAAAAAAGCTGAGGACAATGACGAACAATGCCCTCGGCCCACGACAGCCACGGCAGTGCTTTCAAGCGGC
ATGGAAATACCCAACGTGGCAGCCATAATATCAGCCACGGGCTTCGATGCCGCGCCGAGCCTTGGCTTCTTATCA
GCGTCGGTGCTGGATAAGCTTGGCTTCGCGCCCGACCACGGTGCACAGGTGCTGGCGCTGGGAATGCATGGGACG
CTGCACCCCAACGTAGCACGGCTGGGCTTTGTTGGATTTTACCGGGCTCCGTATTGGGGGGTGATGCAAATGCAG
GCGAGGCTGCTGGCTGCGGTATGGAGTTTGAATGAAGAGCAAGAGGCCAGGAGAGCAGAGGGTAAAGAAAGGACG
AAGAGAGTCAAAGAGGACACGGCTGCGGCAAACGAGACTGATACAGAGGTATACAAGGCCAACAAGGAGACAATG
ATGGAAAAAGGGGACGAACAAGAGGAGAAGGAGACGGCGCAAAATCAACTCTCCAAAGCCCTCAGTGCCGACGAC
TCGATTACCCGCACGCTCGCCCTACGCAACGACACTCGCCTCGCCCAATTCCCCATGGGCGACTACCCGTGGCTC
ATGCAACAATTGTCGGCGGCCCTCTCCATCCCCTTGGTTCCAATTTCGGGGCCACTAAATACGCTCTGTCCAGCG
CGCTACCCTTGCCCCTCGGACGATTCGGTCGCCCAAGGCCAAGCCGCGACGTCTCGAGCCAAGCTCTCACAAACA
ATCTCTTGTGGCCTGTCGACGCCACGCTTTATTCCTCGGGCCGTATTTCGCAGCTTACTCGGAAAATGGAATCTC
CAACGCAGCGTCAGGTCGCGCTCGGCGTCTCATCCCAGTGGAGAATTCTCTGGCATTGCAACCTTTTACCTGCGC
GACACATGGCCTCTGGAATCAAGCTTGGGGTTCGAGTATGTGTACCGCGAGGAGGGCAAGTTTTGCGCTGCAGAC
TCGCGGCTCGAGTTTGAGGCGTCGAGGAGTTATGTTTGGCGCTATGATGAGGCGAGGAATATCGTGTCGGTATGG
TTTGTGCGAACAGACGGTGATGGGACTCGGGCGGTGACGGATTACTTGTTTCATGAGCTCGAGTTTGGTGCTCCG
GCCCAAGAGGGCAAGGGATGGAGTGCGGTGGCGACGCACCTCTGCGTCGAGGACTGGTACAACATGGCCTACGAG
TTTGTGTTTTGTGCCGTCAATTTGCGAAGCTGGAGTGTGCAGTATACCGTCAGCGGCCCCAAAAAGGACTATAGC
ATCAAGGGGACATATACGCGCTAG
Transcript >OphauG2|3543
ATGGCCAAGTCTGTTTGCATTGTCGGAGCGGGACCGTCGGGAGTCGTGGCGGCCAAGACGCTTCTGCACAATGCC
CCGGGCGGAGCTTTTCGCGTCAGTGTGTTTGAGGCACAGAGCAGCGTGGGCGGCCTGTGGCCCAGCAAAGCCGAC
GACAGTCAAGGACGGCCCATTGACGGGCTAATGATGTGTAACCAGAGCCAGCACACCATGCATTTTAGCGACATG
GCGTGGGAGGCGGACACGGGGCAGATGCCGCGGGCGTGGCAGGTTGGACGGTATATTGAGCGCTATGTGCAGCGG
CATCTTGAAGGACAGCCAGGCTTTACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGACAAGAGAGATGGCGGG
TGGGAGATTGAGACGGAAAGGGGCGAGAGGGAGAGGTTTGAGTACTTAGTCGTTGCGTCGGGATACTTTGGAGAA
GCGCGCATTGCGGATGAGGTCAAGGCGGCCTCGGTGCCCGTGGTGCATAGTAGTGCGTACACGGGCCTGGGCAAG
CTGCTAGAGGGGAGAGAGGTGAGTCCAGAGGCAAAGATCTTGGTGGTTGGAGGGCAGTTGTCGGGGCTGGAGGTT
GCGGCGGCCGTGGCGAGGGATATATCGACGGCAAGGTATGGGGAGAGGGAGAGCCGGCTCAACAATGTCGAGACG
CTGAGCGTTGAGCACATTGTGCAAAAGCCAGCATGGGTGATTCCGCTCTATACATGTCCCAAGCCTGAAGGAGCA
GCGCCGGCGTTTTTACCGCTGGATTGCTGTTCGTACAACTTGGCGAATAGAAGTGTCCCTTTGGAGAATACGCAG
GGACATGTAAGTGTTGAAGCAGCGCGGAGAATGCATGGCGTATTCGAGGCCGTCGTGGGGACTGACCAGAGTGAG
TTTGGCATGCGTATTGGAGATGAGGAGAGGGACGAGGTGCCGTATTTGGGGGTGAGTGATGTGTATGCCGATTTT
GTGCGGAGCGGTATGATTTCAGTCGTCAAGGGAAGGCTTGGTTCGGTAGGGGCAGACAAGGCGGCTTCAGACGAC
GCTGCAAAAAAAGCTGAGGACAATGACGAACAATGCCCTCGGCCCACGACAGCCACGGCAGTGCTTTCAAGCGGC
ATGGAAATACCCAACGTGGCAGCCATAATATCAGCCACGGGCTTCGATGCCGCGCCGAGCCTTGGCTTCTTATCA
GCGTCGGTGCTGGATAAGCTTGGCTTCGCGCCCGACCACGGTGCACAGGTGCTGGCGCTGGGAATGCATGGGACG
CTGCACCCCAACGTAGCACGGCTGGGCTTTGTTGGATTTTACCGGGCTCCGTATTGGGGGGTGATGCAAATGCAG
GCGAGGCTGCTGGCTGCGGTATGGAGTTTGAATGAAGAGCAAGAGGCCAGGAGAGCAGAGGGTAAAGAAAGGACG
AAGAGAGTCAAAGAGGACACGGCTGCGGCAAACGAGACTGATACAGAGGTATACAAGGCCAACAAGGAGACAATG
ATGGAAAAAGGGGACGAACAAGAGGAGAAGGAGACGGCGCAAAATCAACTCTCCAAAGCCCTCAGTGCCGACGAC
TCGATTACCCGCACGCTCGCCCTACGCAACGACACTCGCCTCGCCCAATTCCCCATGGGCGACTACCCGTGGCTC
ATGCAACAATTGTCGGCGGCCCTCTCCATCCCCTTGGTTCCAATTTCGGGGCCACTAAATACGCTCTGTCCAGCG
CGCTACCCTTGCCCCTCGGACGATTCGGTCGCCCAAGGCCAAGCCGCGACGTCTCGAGCCAAGCTCTCACAAACA
ATCTCTTGTGGCCTGTCGACGCCACGCTTTATTCCTCGGGCCGTATTTCGCAGCTTACTCGGAAAATGGAATCTC
CAACGCAGCGTCAGGTCGCGCTCGGCGTCTCATCCCAGTGGAGAATTCTCTGGCATTGCAACCTTTTACCTGCGC
GACACATGGCCTCTGGAATCAAGCTTGGGGTTCGAGTATGTGTACCGCGAGGAGGGCAAGTTTTGCGCTGCAGAC
TCGCGGCTCGAGTTTGAGGCGTCGAGGAGTTATGTTTGGCGCTATGATGAGGCGAGGAATATCGTGTCGGTATGG
TTTGTGCGAACAGACGGTGATGGGACTCGGGCGGTGACGGATTACTTGTTTCATGAGCTCGAGTTTGGTGCTCCG
GCCCAAGAGGGCAAGGGATGGAGTGCGGTGGCGACGCACCTCTGCGTCGAGGACTGGTACAACATGGCCTACGAG
TTTGTGTTTTGTGCCGTCAATTTGCGAAGCTGGAGTGTGCAGTATACCGTCAGCGGCCCCAAAAAGGACTATAGC
ATCAAGGGGACATATACGCGCTAG
Gene >OphauG2|3543
ATGGCCAAGTCTGTTTGCATTGTCGGCACGTCAGCCCCGCTTCCTCTCTCTTGCTGCTGTCAAAGGGAGAAGAAG
AGGCCAATTGACTGACGCTTTGCGTCTTCTCCACCACAGGAGCGGGACCGTCGGGAGTCGTGGCGGCCAAGACGC
TTCTGCACAATGCCCCGGGCGGAGCTTTTCGCGTCAGTGTGTTTGAGGCACAGAGCAGCGTGGGCGGCCTGTGGC
CCAGCAAAGCCGACGACAGTCAAGGACGGCCCATTGACGGGCTAATGATGTGTAACCAGAGCCAGCACACCATGC
ATTTTAGCGACATGGCGTGGGAGGCGGACACGGGGCAGATGCCGCGGGCGTGGCAGGTTGGACGGTATATTGAGC
GCTATGTGCAGCGGCATCTTGAAGGACAGCCAGGCTTTACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGACA
AGAGAGATGGCGGGTGGGAGATTGAGACGGAAAGGGGCGAGAGGGAGAGGTTTGAGTACTTAGTCGTTGCGTCGG
GATACTTTGGAGAAGCGCGCATTGCGGATGAGGTCAAGGCGGCCTCGGTGCCCGTGGTGCATAGTAGTGCGTACA
CGGGCCTGGGCAAGCTGCTAGAGGGGAGAGAGGTGAGTCCAGAGGCAAAGATCTTGGTGGTTGGAGGGCAGTTGT
CGGGGCTGGAGGTTGCGGCGGCCGTGGCGAGGGATATATCGACGGCAAGGTATGGGGAGAGGGAGAGCCGGCTCA
ACAATGTCGAGACGCTGAGCGTTGAGCACATTGTGCAAAAGCCAGCATGGGTGATTCCGCTCTATACATGTCCCA
AGGTGGGTATCTCCAGGTGGGCATCTCCACAAGACGAAAGAAAACCGAGACTAACCTAGTGTCTTGTTGTCGATT
GTTGGTGCTATAGCCTGAAGGAGCAGCGCCGGCGTTTTTACCGCTGGATTGCTGTTCGTACAACTTGGCGAATAG
AAGTGTCCCTTTGGAGAATACGCAGGGACATGTAAGTGTTGAAGCAGCGCGGAGAATGCATGGCGTATTCGAGGC
CGTCGTGGGGACTGACCAGAGTGAGTTTGGCATGCGTATTGGAGATGAGGAGAGGGACGAGGTGCCGTATTTGGG
GGTGAGTGATGTGTATGCCGATTTTGTGCGGAGCGGTATGATTTCAGTCGTCAAGGGAAGGCTTGGTTCGGTAGG
GGCAGACAAGGCGGCTTCAGACGACGCTGCAAAAAAAGCTGAGGACAATGACGAACAATGCCCTCGGCCCACGAC
AGCCACGGCAGTGCTTTCAAGCGGCATGGAAATACCCAACGTGGCAGCCATAATATCAGCCACGGGCTTCGATGC
CGCGCCGAGCCTTGGCTTCTTATCAGCGTCGGTGCTGGATAAGCTTGGCTTCGCGCCCGACCACGGTGCACAGGT
GCTGGCGCTGGGAATGCATGGGACGCTGCACCCCAACGTAGCACGGCTGGGCTTTGTTGGATTTTACCGGGCTCC
GTATTGGGGGGTGATGCAAATGCAGGCGAGGCTGCTGGCTGCGGTATGGAGTTTGAATGAAGAGCAAGAGGCCAG
GAGAGCAGAGGGTAAAGAAAGGACGAAGAGAGTCAAAGAGGACACGGCTGCGGCAAACGAGACTGATACAGAGGT
ATACAAGGCCAACAAGGAGACAATGATGGAAAAAGGGGACGAACAAGAGGAGAAGGAGACGGCGCAAAATCAACT
CTCCAAAGCCCTCAGTGCCGACGACTCGATTACCCGCACGCTCGCCCTACGCAACGACACTCGCCTCGCCCAATT
CCCCATGGGCGACTACCCGTGGCTCATGCAACAATTGTCGGCGGCCCTCTCCATCCCCTTGGTTCCAATTTCGGG
GCCACTAAATACGCTCTGTCCAGCGCGCTACCCTTGCCCCTCGGACGATTCGGTCGCCCAAGGCCAAGCCGCGAC
GTCTCGAGCCAAGCTCTCACAAACAATCTCTTGTGGCCTGTCGACGCCACGCTTTATTCCTCGGGCCGTATTTCG
CAGCTTACTCGGAAAATGGAATCTCCAACGCAGCGTCAGGTCGCGCTCGGCGTCTCATCCCAGTGGAGAATTCTC
TGGCATTGCAACCTTTTACCTGCGCGACACATGGCCTCTGGAATCAAGCTTGGGGTTCGAGTATGTGTACCGCGA
GGAGGGCAAGTTTTGCGCTGCAGACTCGCGGCTCGAGTTTGAGGCGTCGAGGAGTTATGTTTGGCGCTATGATGA
GGCGAGGAATATCGTGTCGGTATGGTTTGTGCGAACAGACGGTGATGGGACTCGGGCGGTGACGGATTACTTGTT
TCATGAGCTCGAGTTTGGTGCTCCGGCCCAAGAGGGCAAGGGATGGAGTGCGGTGGCGACGCACCTCTGCGTCGA
GGACTGGTACAACATGGCCTACGAGTTTGTGTTTTGTGCCGTCAATTTGCGAAGCTGGAGTGTGCAGTATACCGT
CAGCGGCCCCAAAAAGGACTATAGCATCAAGGGGACATATACGCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail