Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3541
Gene name
LocationContig_271:6926..7970
Strand-
Gene length (bp)1044
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 2.3E-53 111 299
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 2.9E-27 6 329
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 3.7E-06 146 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52643|LDHD_ECOLI D-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=ldhA PE=1 SV=1 1 330 6.0E-120
sp|P44501|DDH_HAEIN 2-hydroxyacid dehydrogenase homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddh PE=3 SV=1 1 328 5.0E-116
sp|Q9P7Q1|DDH2_SCHPO 2-hydroxyacid dehydrogenase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.02c PE=3 SV=1 1 330 9.0E-107
sp|P30799|DDH_ZYMMO 2-hydroxyacid dehydrogenase homolog OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ddh PE=3 SV=3 1 330 3.0E-104
sp|Q9P7P8|DDH1_SCHPO 2-hydroxyacid dehydrogenase homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.07c PE=3 SV=1 1 333 3.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52643|LDHD_ECOLI D-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=ldhA PE=1 SV=1 1 330 6.0E-120
sp|P44501|DDH_HAEIN 2-hydroxyacid dehydrogenase homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddh PE=3 SV=1 1 328 5.0E-116
sp|Q9P7Q1|DDH2_SCHPO 2-hydroxyacid dehydrogenase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.02c PE=3 SV=1 1 330 9.0E-107
sp|P30799|DDH_ZYMMO 2-hydroxyacid dehydrogenase homolog OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ddh PE=3 SV=3 1 330 3.0E-104
sp|Q9P7P8|DDH1_SCHPO 2-hydroxyacid dehydrogenase homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.07c PE=3 SV=1 1 333 3.0E-100
sp|Q54UF7|LDHD_DICDI Putative D-lactate dehydrogenase OS=Dictyostelium discoideum GN=ldhA PE=1 SV=1 1 334 3.0E-87
sp|G9EZR6|FLDH_CLOS3 Phenyllactate dehydrogenase OS=Clostridium sporogenes (strain ATCC 7955 / DSM 767 / NBRC 16411 / NCIMB 8053 / NCTC 8594 / PA 3679) GN=fldH PE=1 SV=1 41 328 5.0E-70
sp|Q8E0N5|LDHD_STRA5 D-lactate dehydrogenase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ldhD PE=3 SV=1 1 330 9.0E-63
sp|Q8E6A9|LDHD_STRA3 D-lactate dehydrogenase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ldhD PE=3 SV=1 1 314 4.0E-59
sp|Q88VJ2|LDHD_LACPL D-lactate dehydrogenase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ldhD PE=3 SV=1 34 333 9.0E-59
sp|P26298|LDHD_LACPE D-lactate dehydrogenase OS=Lactobacillus pentosus PE=1 SV=1 34 333 2.0E-57
sp|P26297|LDHD_LACDA D-lactate dehydrogenase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ldhA PE=1 SV=3 9 320 1.0E-56
sp|Q8CN22|LDHD_STAES D-lactate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ldhD PE=3 SV=1 2 330 1.0E-55
sp|Q5HLA0|LDHD_STAEQ D-lactate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ldhD PE=3 SV=1 2 330 1.0E-55
sp|P30901|LDHD_LACHE D-lactate dehydrogenase OS=Lactobacillus helveticus PE=1 SV=2 2 316 6.0E-54
sp|Q47748|VANH_ENTFA D-specific alpha-keto acid dehydrogenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=vanHB PE=3 SV=2 1 316 1.0E-53
sp|Q6GDS2|LDHD_STAAR D-lactate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=ldhD PE=3 SV=1 2 330 1.0E-52
sp|P17584|DHD2_LACPA D-2-hydroxyisocaproate dehydrogenase OS=Lactobacillus paracasei PE=1 SV=2 1 331 3.0E-52
sp|Q59642|LDHD_PEDAC D-lactate dehydrogenase OS=Pediococcus acidilactici GN=ldhD PE=3 SV=1 1 330 3.0E-51
sp|P99116|LDHD_STAAN D-lactate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=ldhD PE=1 SV=1 2 330 3.0E-51
sp|P63940|LDHD_STAAM D-lactate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ldhD PE=3 SV=1 2 330 3.0E-51
sp|P72357|LDHD_STAAU D-lactate dehydrogenase OS=Staphylococcus aureus GN=ldhD PE=1 SV=1 2 330 4.0E-51
sp|Q5HD29|LDHD_STAAC D-lactate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=ldhD PE=3 SV=1 2 330 4.0E-51
sp|P51011|LDHD_LEUMC D-lactate dehydrogenase OS=Leuconostoc mesenteroides subsp. cremoris PE=3 SV=1 34 321 1.0E-50
sp|Q8NUT2|LDHD_STAAW D-lactate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=ldhD PE=3 SV=2 2 330 5.0E-50
sp|Q6G6F1|LDHD_STAAS D-lactate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=ldhD PE=3 SV=1 2 330 5.0E-50
sp|O83080|LDHD_TREPA D-lactate dehydrogenase OS=Treponema pallidum (strain Nichols) GN=ldhD PE=3 SV=1 1 326 2.0E-48
sp|Q99ZM2|LDHD_STRP1 D-lactate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=ldhD PE=3 SV=1 1 327 1.0E-47
sp|Q05709|VANH_ENTFC D-specific alpha-keto acid dehydrogenase OS=Enterococcus faecium GN=vanH PE=1 SV=1 49 316 2.0E-47
sp|A1RYE4|GYAR_THEPD Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1 43 316 1.0E-40
sp|B1L765|GYAR_KORCO Glyoxylate reductase OS=Korarchaeum cryptofilum (strain OPF8) GN=gyaR PE=3 SV=1 1 316 2.0E-40
sp|Q9C4M5|GYAR_THELN Glyoxylate reductase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=gyaR PE=1 SV=1 43 333 3.0E-40
sp|Q9YAW4|GYAR_AERPE Glyoxylate reductase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gyaR PE=3 SV=2 42 342 4.0E-39
sp|Q9X1C1|HPR_THEMA Hydroxypyruvate reductase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1401 PE=1 SV=1 63 305 1.0E-37
sp|Q58424|SERA_METJA D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=serA PE=3 SV=1 68 305 2.0E-36
sp|Q8U3Y2|GYAR_PYRFU Glyoxylate reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gyaR PE=3 SV=1 43 316 3.0E-36
sp|O27051|SERA_METTH D-3-phosphoglycerate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=serA PE=3 SV=1 58 265 2.0E-35
sp|B6YWH0|GYAR_THEON Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1 43 316 4.0E-35
sp|P73821|SERA_SYNY3 D-3-phosphoglycerate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=serA PE=3 SV=1 63 310 3.0E-34
sp|Q5JEZ2|GYAR_THEKO Glyoxylate reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gyaR PE=3 SV=1 43 316 5.0E-33
sp|P35136|SERA_BACSU D-3-phosphoglycerate dehydrogenase OS=Bacillus subtilis (strain 168) GN=serA PE=3 SV=3 78 265 1.0E-32
sp|O29445|SERA_ARCFU D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serA PE=3 SV=1 63 305 1.0E-32
sp|Q61753|SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3 78 310 4.0E-32
sp|A5A6P1|SERA_PANTR D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes GN=PHGDH PE=2 SV=1 78 310 5.0E-32
sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4 78 310 6.0E-32
sp|Q1QWN6|SLCC_CHRSD (S)-sulfolactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=slcC PE=1 SV=1 68 316 8.0E-32
sp|Q60HD7|SERA_MACFA D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4 78 310 8.0E-32
sp|Q5EAD2|SERA_BOVIN D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3 78 310 9.0E-32
sp|Q0VCQ1|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus GN=CTBP2 PE=1 SV=1 69 330 1.0E-31
sp|O46036|CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster GN=CtBP PE=1 SV=3 69 317 1.0E-31
sp|Q9W758|CTBP2_XENLA C-terminal-binding protein 2 OS=Xenopus laevis GN=ctbp2 PE=1 SV=1 69 333 2.0E-31
sp|O08651|SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus GN=Phgdh PE=1 SV=3 78 310 2.0E-31
sp|P56546|CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus GN=Ctbp2 PE=1 SV=2 69 330 2.0E-31
sp|Q9EQH5|CTBP2_RAT C-terminal-binding protein 2 OS=Rattus norvegicus GN=Ctbp2 PE=1 SV=2 69 330 2.0E-31
sp|P56545|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens GN=CTBP2 PE=1 SV=1 69 330 3.0E-31
sp|P9WNX3|SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=serA PE=1 SV=1 45 271 5.0E-31
sp|P9WNX2|SERA_MYCTO D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=serA PE=3 SV=1 45 271 5.0E-31
sp|P0A545|SERA_MYCBO D-3-phosphoglycerate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=serA PE=3 SV=1 45 271 5.0E-31
sp|O04130|SERA2_ARATH D-3-phosphoglycerate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=PGDH2 PE=1 SV=2 65 310 2.0E-30
sp|A5GFY8|SERA_PIG D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1 78 310 3.0E-30
sp|Q5R7M2|SERA_PONAB D-3-phosphoglycerate dehydrogenase OS=Pongo abelii GN=PHGDH PE=2 SV=3 78 310 4.0E-30
sp|P45250|Y1556_HAEIN Putative 2-hydroxyacid dehydrogenase HI_1556 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1556 PE=1 SV=1 64 319 5.0E-30
sp|Q13363|CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens GN=CTBP1 PE=1 SV=2 69 333 6.0E-30
sp|Q9Z2F5|CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus GN=Ctbp1 PE=1 SV=3 69 333 7.0E-30
sp|O88712|CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus GN=Ctbp1 PE=1 SV=2 69 333 8.0E-30
sp|P43885|SERA_HAEIN D-3-phosphoglycerate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=serA PE=3 SV=1 76 331 1.0E-29
sp|Q59516|DHGY_METEA Glycerate dehydrogenase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=hprA PE=1 SV=3 12 322 2.0E-29
sp|O33116|SERA_MYCLE D-3-phosphoglycerate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=serA PE=3 SV=1 45 271 2.0E-29
sp|O49485|SERA1_ARATH D-3-phosphoglycerate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=PGDH1 PE=1 SV=1 78 310 2.0E-29
sp|Q9YHU0|CTBP1_XENLA C-terminal-binding protein 1 OS=Xenopus laevis GN=ctbp1 PE=2 SV=1 69 333 2.0E-29
sp|Q9S7E4|FDH_ARATH Formate dehydrogenase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FDH1 PE=1 SV=1 78 307 3.0E-29
sp|Q9LT69|SERA3_ARATH D-3-phosphoglycerate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=PGDH3 PE=1 SV=1 78 323 4.0E-29
sp|Q9SXP2|FDH1_ORYSJ Formate dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486800 PE=1 SV=2 57 262 1.0E-28
sp|Q67U69|FDH2_ORYSJ Formate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486900 PE=2 SV=1 57 262 1.0E-28
sp|C5A1V0|GYAR_THEGJ Glyoxylate reductase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gyaR PE=3 SV=1 43 316 3.0E-28
sp|Q9ZRI8|FDH_HORVU Formate dehydrogenase, mitochondrial OS=Hordeum vulgare PE=2 SV=1 78 262 2.0E-27
sp|Q07511|FDH_SOLTU Formate dehydrogenase, mitochondrial OS=Solanum tuberosum GN=FDH1 PE=1 SV=2 57 262 2.0E-27
sp|Q20595|CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans GN=ctbp-1 PE=1 SV=3 64 331 5.0E-27
sp|Q03134|FDH_EMENI Formate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aciA PE=2 SV=3 68 273 7.0E-27
sp|P87228|SERA_SCHPO Putative D-3-phosphoglycerate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC364.07 PE=1 SV=1 76 305 2.0E-26
sp|O32264|TKRA_BACSU Probable 2-ketogluconate reductase OS=Bacillus subtilis (strain 168) GN=yvcT PE=3 SV=1 68 286 2.0E-26
sp|P0A9T3|SERA_SHIFL D-3-phosphoglycerate dehydrogenase OS=Shigella flexneri GN=serA PE=3 SV=2 76 310 8.0E-26
sp|P0A9T0|SERA_ECOLI D-3-phosphoglycerate dehydrogenase OS=Escherichia coli (strain K12) GN=serA PE=1 SV=2 76 310 8.0E-26
sp|P0A9T1|SERA_ECOL6 D-3-phosphoglycerate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=serA PE=3 SV=2 76 310 8.0E-26
sp|P0A9T2|SERA_ECO57 D-3-phosphoglycerate dehydrogenase OS=Escherichia coli O157:H7 GN=serA PE=3 SV=2 76 310 8.0E-26
sp|P53839|GOR1_YEAST Glyoxylate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOR1 PE=1 SV=1 77 337 9.0E-26
sp|P58000|GHRB_ENTAG Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter agglomerans GN=tkrA PE=1 SV=1 78 265 9.0E-26
sp|Q31V71|GHRB_SHIBS Glyoxylate/hydroxypyruvate reductase B OS=Shigella boydii serotype 4 (strain Sb227) GN=ghrB PE=3 SV=2 53 265 2.0E-25
sp|Q49ZM5|Y606_STAS1 Putative 2-hydroxyacid dehydrogenase SSP0606 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0606 PE=3 SV=1 36 297 2.0E-25
sp|A8ARD9|GHRB_CITK8 Glyoxylate/hydroxypyruvate reductase B OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ghrB PE=3 SV=1 78 316 5.0E-25
sp|B5XMZ4|GHRB_KLEP3 Glyoxylate/hydroxypyruvate reductase B OS=Klebsiella pneumoniae (strain 342) GN=ghrB PE=3 SV=1 78 316 5.0E-25
sp|Q83PR3|GHRB_SHIFL Glyoxylate/hydroxypyruvate reductase B OS=Shigella flexneri GN=ghrB PE=3 SV=4 53 265 7.0E-25
sp|P13443|DHGY_CUCSA Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-A PE=2 SV=1 64 265 7.0E-25
sp|A6TFG7|GHRB_KLEP7 Glyoxylate/hydroxypyruvate reductase B OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ghrB PE=3 SV=1 62 316 8.0E-25
sp|A7MKR1|GHRB_CROS8 Glyoxylate/hydroxypyruvate reductase B OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ghrB PE=3 SV=1 78 316 1.0E-24
sp|B1LJB3|GHRB_ECOSM Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ghrB PE=3 SV=1 53 265 1.0E-24
sp|Q9C9W5|HPR1_ARATH Glycerate dehydrogenase HPR, peroxisomal OS=Arabidopsis thaliana GN=HPR PE=1 SV=1 46 265 2.0E-24
sp|Q3YVT5|GHRB_SHISS Glyoxylate/hydroxypyruvate reductase B OS=Shigella sonnei (strain Ss046) GN=ghrB PE=3 SV=2 53 265 2.0E-24
sp|B5EX58|GHRB_SALA4 Glyoxylate/hydroxypyruvate reductase B OS=Salmonella agona (strain SL483) GN=ghrB PE=3 SV=1 78 265 2.0E-24
sp|B1IZP1|GHRB_ECOLC Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|B2U573|GHRB_SHIB3 Glyoxylate/hydroxypyruvate reductase B OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|Q1R543|GHRB_ECOUT Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain UTI89 / UPEC) GN=ghrB PE=3 SV=2 53 265 2.0E-24
sp|B6I3C3|GHRB_ECOSE Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain SE11) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|A1AH96|GHRB_ECOK1 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O1:K1 / APEC GN=ghrB PE=3 SV=2 53 265 2.0E-24
sp|B7M3H6|GHRB_ECO8A Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O8 (strain IAI1) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|B7N1K7|GHRB_ECO81 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O81 (strain ED1a) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|B5YVK6|GHRB_ECO5E Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|P58220|GHRB_ECO57 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 GN=tkrA PE=3 SV=1 53 265 2.0E-24
sp|B7L6W9|GHRB_ECO55 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain 55989 / EAEC) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|B7MER0|GHRB_ECO45 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|B7ULB4|GHRB_ECO27 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|A7ZTA0|GHRB_ECO24 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ghrB PE=3 SV=1 53 265 2.0E-24
sp|A8G7S7|GHRB_SERP5 Glyoxylate/hydroxypyruvate reductase B OS=Serratia proteamaculans (strain 568) GN=ghrB PE=3 SV=1 78 316 3.0E-24
sp|P37666|GHRB_ECOLI Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12) GN=ghrB PE=1 SV=3 53 265 3.0E-24
sp|B1X8G8|GHRB_ECODH Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12 / DH10B) GN=ghrB PE=3 SV=1 53 265 3.0E-24
sp|C4ZXE2|GHRB_ECOBW Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ghrB PE=3 SV=1 53 265 3.0E-24
sp|P36234|DHGY_HYPME Glycerate dehydrogenase OS=Hyphomicrobium methylovorum PE=1 SV=2 2 268 3.0E-24
sp|B7NP49|GHRB_ECO7I Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ghrB PE=3 SV=1 68 265 3.0E-24
sp|A8A609|GHRB_ECOHS Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O9:H4 (strain HS) GN=ghrB PE=3 SV=1 53 265 3.0E-24
sp|Q663W4|GHRB_YERPS Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|A4TGN1|GHRB_YERPP Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis (strain Pestoides F) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|A9R4G6|GHRB_YERPG Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|Q0W9V5|GHRB_YERPE Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|B2K7F1|GHRB_YERPB Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|Q1C3K4|GHRB_YERPA Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|A7FPA2|GHRB_YERP3 Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|B1JH01|GHRB_YERPY Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ghrB PE=3 SV=1 68 316 4.0E-24
sp|B2VCD1|GHRB_ERWT9 Glyoxylate/hydroxypyruvate reductase B OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ghrB PE=3 SV=1 78 265 5.0E-24
sp|A1JT62|GHRB_YERE8 Glyoxylate/hydroxypyruvate reductase B OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ghrB PE=3 SV=1 78 338 5.0E-24
sp|B7NEK6|GHRB_ECOLU Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ghrB PE=3 SV=1 53 265 6.0E-24
sp|C0Q1A7|GHRB_SALPC Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi C (strain RKS4594) GN=ghrB PE=3 SV=1 78 265 6.0E-24
sp|Q57IH8|GHRB_SALCH Glyoxylate/hydroxypyruvate reductase B OS=Salmonella choleraesuis (strain SC-B67) GN=ghrB PE=3 SV=1 78 265 6.0E-24
sp|B4TZ41|GHRB_SALSV Glyoxylate/hydroxypyruvate reductase B OS=Salmonella schwarzengrund (strain CVM19633) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|B7LTG7|GHRB_ESCF3 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|O94574|YGDH_SCHPO Putative 2-hydroxyacid dehydrogenase C1773.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.17c PE=3 SV=3 40 330 7.0E-24
sp|Q8ZLA1|GHRB_SALTY Glyoxylate/hydroxypyruvate reductase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|B4T938|GHRB_SALHS Glyoxylate/hydroxypyruvate reductase B OS=Salmonella heidelberg (strain SL476) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|Q0SZE5|GHRB_SHIF8 Glyoxylate/hydroxypyruvate reductase B OS=Shigella flexneri serotype 5b (strain 8401) GN=ghrB PE=3 SV=1 53 265 7.0E-24
sp|B4SWJ5|GHRB_SALNS Glyoxylate/hydroxypyruvate reductase B OS=Salmonella newport (strain SL254) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|B5R4N3|GHRB_SALEP Glyoxylate/hydroxypyruvate reductase B OS=Salmonella enteritidis PT4 (strain P125109) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|B5FLC2|GHRB_SALDC Glyoxylate/hydroxypyruvate reductase B OS=Salmonella dublin (strain CT_02021853) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|A9MUT4|GHRB_SALPB Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|Q8Z2A8|GHRB_SALTI Glyoxylate/hydroxypyruvate reductase B OS=Salmonella typhi GN=ghrB PE=3 SV=1 78 265 7.0E-24
sp|B5BHT3|GHRB_SALPK Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi A (strain AKU_12601) GN=ghrB PE=3 SV=1 78 265 9.0E-24
sp|Q5PLL9|GHRB_SALPA Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ghrB PE=3 SV=1 78 265 9.0E-24
sp|Q9LE33|HPR3_ARATH Glyoxylate/hydroxypyruvate reductase HPR3 OS=Arabidopsis thaliana GN=HPR3 PE=2 SV=1 68 316 9.0E-24
sp|O69054|PTXD_PSEST Phosphonate dehydrogenase OS=Pseudomonas stutzeri GN=ptxD PE=1 SV=1 43 334 9.0E-24
sp|Q8FCF1|GHRB_ECOL6 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ghrB PE=3 SV=2 53 265 1.0E-23
sp|Q0TBP9|GHRB_ECOL5 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ghrB PE=3 SV=1 53 265 1.0E-23
sp|Q1CD80|GHRB_YERPN Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ghrB PE=3 SV=1 68 316 1.0E-23
sp|Q5HLU4|Y1888_STAEQ Putative 2-hydroxyacid dehydrogenase SERP1888 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1888 PE=3 SV=1 24 312 1.0E-23
sp|Q8CNB8|Y1879_STAES Putative 2-hydroxyacid dehydrogenase SE_1879 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1879 PE=3 SV=1 24 312 2.0E-23
sp|Q6GEC9|Y2389_STAAR Putative 2-hydroxyacid dehydrogenase SAR2389 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2389 PE=3 SV=1 63 312 2.0E-23
sp|Q328L4|GHRB_SHIDS Glyoxylate/hydroxypyruvate reductase B OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ghrB PE=3 SV=2 53 265 2.0E-23
sp|Q2YYT9|Y2178_STAAB Putative 2-hydroxyacid dehydrogenase SAB2178 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2178 PE=3 SV=1 63 312 3.0E-23
sp|P40054|SERA_YEAST D-3-phosphoglycerate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER3 PE=1 SV=1 76 310 3.0E-23
sp|B5RGN1|GHRB_SALG2 Glyoxylate/hydroxypyruvate reductase B OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ghrB PE=3 SV=1 78 265 3.0E-23
sp|A4W577|GHRB_ENT38 Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter sp. (strain 638) GN=ghrB PE=3 SV=1 78 265 3.0E-23
sp|Q2FVW4|Y2577_STAA8 Putative 2-hydroxyacid dehydrogenase SAOUHSC_02577 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02577 PE=3 SV=1 63 312 3.0E-23
sp|Q5HDQ4|Y2296_STAAC Putative 2-hydroxyacid dehydrogenase SACOL2296 OS=Staphylococcus aureus (strain COL) GN=SACOL2296 PE=3 SV=1 63 312 3.0E-23
sp|Q2FEI9|Y2254_STAA3 Putative 2-hydroxyacid dehydrogenase SAUSA300_2254 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2254 PE=3 SV=1 63 312 3.0E-23
sp|Q8NV80|Y2224_STAAW Putative 2-hydroxyacid dehydrogenase MW2224 OS=Staphylococcus aureus (strain MW2) GN=MW2224 PE=3 SV=1 63 312 3.0E-23
sp|Q6G716|Y2196_STAAS Putative 2-hydroxyacid dehydrogenase SAS2196 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2196 PE=3 SV=1 63 312 3.0E-23
sp|P40510|SER33_YEAST D-3-phosphoglycerate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER33 PE=1 SV=1 76 310 5.0E-23
sp|Q99RW8|Y2305_STAAM Putative 2-hydroxyacid dehydrogenase SAV2305 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2305 PE=3 SV=1 63 312 1.0E-22
sp|Q7A417|Y2098_STAAN Putative 2-hydroxyacid dehydrogenase SA2098 OS=Staphylococcus aureus (strain N315) GN=SA2098 PE=1 SV=1 63 312 1.0E-22
sp|P33160|FDH_PSESR Formate dehydrogenase OS=Pseudomonas sp. (strain 101) PE=1 SV=3 37 262 2.0E-22
sp|C6DJ88|GHRB_PECCP Glyoxylate/hydroxypyruvate reductase B OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ghrB PE=3 SV=1 78 316 8.0E-22
sp|O34815|YOAD_BACSU Putative 2-hydroxyacid dehydrogenase YoaD OS=Bacillus subtilis (strain 168) GN=yoaD PE=2 SV=1 54 265 2.0E-21
sp|O58320|GYAR_PYRHO Glyoxylate reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gyaR PE=1 SV=2 43 265 5.0E-21
sp|B8EEB4|PDXB_SHEB2 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS223) GN=pdxB PE=3 SV=1 78 265 5.0E-21
sp|A6WQ07|PDXB_SHEB8 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS185) GN=pdxB PE=3 SV=1 78 265 1.0E-20
sp|Q4L8G4|Y752_STAHJ Putative 2-hydroxyacid dehydrogenase SH0752 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0752 PE=3 SV=1 68 265 1.0E-20
sp|Q65CJ7|HPPR_PLESU Hydroxyphenylpyruvate reductase OS=Plectranthus scutellarioides GN=HPPR PE=1 SV=2 44 265 2.0E-20
sp|A1RIA7|PDXB_SHESW Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=pdxB PE=3 SV=1 78 265 2.0E-20
sp|A4Y882|PDXB_SHEPC Erythronate-4-phosphate dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pdxB PE=3 SV=1 78 265 2.0E-20
sp|Q54UH8|SERA_DICDI D-3-phosphoglycerate dehydrogenase OS=Dictyostelium discoideum GN=serA PE=1 SV=1 76 310 2.0E-20
sp|Q3K9D1|PDXB_PSEPF Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pdxB PE=3 SV=1 78 265 1.0E-19
sp|Q0HWL8|PDXB_SHESR Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=pdxB PE=3 SV=1 78 265 1.0E-19
sp|Q0HKB6|PDXB_SHESM Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-4) GN=pdxB PE=3 SV=1 78 265 2.0E-19
sp|B0TKZ7|PDXB_SHEHH Erythronate-4-phosphate dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pdxB PE=3 SV=1 62 265 2.0E-19
sp|Q9CA90|HPR2_ARATH Glyoxylate/hydroxypyruvate reductase A HPR2 OS=Arabidopsis thaliana GN=HPR2 PE=1 SV=1 68 265 3.0E-19
sp|A9KTV0|PDXB_SHEB9 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS195) GN=pdxB PE=3 SV=1 78 265 3.0E-19
sp|Q8ECR2|PDXB_SHEON Erythronate-4-phosphate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=pdxB PE=3 SV=1 78 265 3.0E-19
sp|A3D669|PDXB_SHEB5 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pdxB PE=3 SV=1 78 265 4.0E-19
sp|Q084S1|PDXB_SHEFN Erythronate-4-phosphate dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pdxB PE=3 SV=1 78 265 7.0E-19
sp|A3QFC7|PDXB_SHELP Erythronate-4-phosphate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pdxB PE=3 SV=1 78 265 3.0E-18
sp|A0KV91|PDXB_SHESA Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=pdxB PE=3 SV=1 78 265 3.0E-18
sp|Q56733|PDXB_SHEVD Erythronate-4-phosphate dehydrogenase OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=pdxB PE=3 SV=2 78 271 4.0E-18
sp|Q9UYR1|GYAR_PYRAB Glyoxylate reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gyaR PE=3 SV=1 43 261 4.0E-18
sp|Q5FTU6|2KGR_GLUOX 2-ketogluconate reductase OS=Gluconobacter oxydans (strain 621H) GN=GOX0417 PE=1 SV=1 56 306 5.0E-18
sp|Q54DP1|TKRA_DICDI Probable 2-ketogluconate reductase OS=Dictyostelium discoideum GN=tkrA PE=3 SV=1 54 316 5.0E-18
sp|Q2S0U3|PDXB_SALRD Erythronate-4-phosphate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pdxB PE=3 SV=1 78 267 5.0E-18
sp|Q3IF36|PDXB_PSEHT Erythronate-4-phosphate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pdxB PE=3 SV=1 78 271 6.0E-18
sp|G0SGU4|FDH_CHATD Formate dehydrogenase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=FDH PE=1 SV=1 78 262 1.0E-17
sp|Q9UBQ7|GRHPR_HUMAN Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens GN=GRHPR PE=1 SV=1 65 265 1.0E-17
sp|Q4ZVE7|PDXB_PSEU2 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pdxB PE=3 SV=1 78 265 2.0E-17
sp|Q5LIR8|PDXB_BACFN Erythronate-4-phosphate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pdxB PE=3 SV=1 62 271 2.0E-17
sp|Q07103|FDH_NEUCR Formate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fdh PE=2 SV=1 78 262 4.0E-17
sp|O14075|YEAA_SCHPO Putative 2-hydroxyacid dehydrogenase UNK4.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.10 PE=2 SV=1 68 268 5.0E-17
sp|Q12P58|PDXB_SHEDO Erythronate-4-phosphate dehydrogenase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pdxB PE=3 SV=1 78 265 7.0E-17
sp|Q64ZV5|PDXB_BACFR Erythronate-4-phosphate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=pdxB PE=3 SV=1 62 271 7.0E-17
sp|Q08911|FDH1_YEAST Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FDH1 PE=1 SV=1 46 265 8.0E-17
sp|N1P3Y5|FDH1_YEASC Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=FDH1 PE=2 SV=1 46 265 8.0E-17
sp|C8ZHD6|FDH1_YEAS8 Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=FDH1 PE=2 SV=1 46 265 8.0E-17
sp|A6ZN46|FDH1_YEAS7 Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FDH1 PE=2 SV=1 46 265 8.0E-17
sp|P0CT22|FDH2_YEASC Formate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=FDH2 PE=2 SV=1 46 265 8.0E-17
sp|B7VL81|PDXB_VIBTL Erythronate-4-phosphate dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=pdxB PE=3 SV=1 68 271 8.0E-17
sp|Q8DB36|PDXB_VIBVU Erythronate-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=pdxB PE=3 SV=2 62 271 1.0E-16
sp|Q6DB24|GHRB_PECAS Glyoxylate/hydroxypyruvate reductase B OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ghrB PE=3 SV=2 78 316 1.0E-16
sp|Q7MIT6|PDXB_VIBVY Erythronate-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=pdxB PE=3 SV=2 68 271 2.0E-16
sp|Q9KQ92|PDXB_VIBCH Erythronate-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pdxB PE=1 SV=2 62 271 2.0E-16
sp|Q8D2P6|PDXB_WIGBR Erythronate-4-phosphate dehydrogenase OS=Wigglesworthia glossinidia brevipalpis GN=pdxB PE=3 SV=1 63 265 5.0E-16
sp|Q87MN8|PDXB_VIBPA Erythronate-4-phosphate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pdxB PE=3 SV=1 68 271 5.0E-16
sp|B0KGD9|PDXB_PSEPG Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=pdxB PE=3 SV=1 160 265 1.0E-15
sp|Q0VQC3|PDXB_ALCBS Erythronate-4-phosphate dehydrogenase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pdxB PE=3 SV=2 62 265 1.0E-15
sp|B3PK14|PDXB_CELJU Erythronate-4-phosphate dehydrogenase OS=Cellvibrio japonicus (strain Ueda107) GN=pdxB PE=3 SV=1 142 271 2.0E-15
sp|Q4FV16|PDXB_PSYA2 Erythronate-4-phosphate dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pdxB PE=3 SV=2 62 265 2.0E-15
sp|Q1QE21|PDXB_PSYCK Erythronate-4-phosphate dehydrogenase OS=Psychrobacter cryohalolentis (strain K5) GN=pdxB PE=3 SV=1 78 265 2.0E-15
sp|P0C1E9|YPRB2_CORML Uncharacterized protein in proB 3'region OS=Corynebacterium melassecola PE=3 SV=1 145 316 3.0E-15
sp|A4XTK4|PDXB_PSEMY Erythronate-4-phosphate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=pdxB PE=3 SV=1 160 265 4.0E-15
sp|Q91Z53|GRHPR_MOUSE Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus GN=Grhpr PE=1 SV=1 68 265 4.0E-15
sp|P0C1E8|Y2355_CORGL Uncharacterized protein Cgl2355/cg2587 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl2355 PE=3 SV=1 46 316 5.0E-15
sp|Q1I7B3|PDXB_PSEE4 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=pdxB PE=3 SV=1 160 265 5.0E-15
sp|A8FTT7|PDXB_SHESH Erythronate-4-phosphate dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=pdxB PE=3 SV=1 68 265 5.0E-15
sp|A5W6I8|PDXB_PSEP1 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pdxB PE=3 SV=1 160 265 5.0E-15
sp|Q88L20|PDXB_PSEPK Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=pdxB PE=3 SV=1 160 265 6.0E-15
sp|B1KKP1|PDXB_SHEWM Erythronate-4-phosphate dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pdxB PE=3 SV=1 78 265 8.0E-15
sp|Q15QG8|PDXB_PSEA6 Erythronate-4-phosphate dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pdxB PE=3 SV=1 1 265 1.0E-14
sp|Q6LNU2|PDXB_PHOPR Erythronate-4-phosphate dehydrogenase OS=Photobacterium profundum GN=pdxB PE=3 SV=1 76 265 2.0E-14
sp|Q56731|PDXB_SHESP Erythronate-4-phosphate dehydrogenase (Fragment) OS=Shewanella sp. (strain DB6705) GN=pdxB PE=3 SV=1 142 271 2.0E-14
sp|Q4KFD1|PDXB_PSEF5 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pdxB PE=3 SV=1 160 265 2.0E-14
sp|Q7VRU9|PDXB_BLOFL Erythronate-4-phosphate dehydrogenase OS=Blochmannia floridanus GN=pdxB PE=3 SV=1 63 268 3.0E-14
sp|Q8A2E4|PDXB_BACTN Erythronate-4-phosphate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pdxB PE=3 SV=1 63 271 3.0E-14
sp|A1S7K2|PDXB_SHEAM Erythronate-4-phosphate dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pdxB PE=3 SV=1 78 267 3.0E-14
sp|A6VXM3|PDXB_MARMS Erythronate-4-phosphate dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=pdxB PE=3 SV=1 145 265 4.0E-14
sp|B1J5D7|PDXB_PSEPW Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain W619) GN=pdxB PE=3 SV=1 160 265 5.0E-14
sp|O13437|FDH_CANBO Formate dehydrogenase OS=Candida boidinii GN=FDH1 PE=1 SV=1 68 262 5.0E-14
sp|C3K5G7|PDXB_PSEFS Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=pdxB PE=3 SV=1 78 265 6.0E-14
sp|C1DM66|PDXB_AZOVD Erythronate-4-phosphate dehydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pdxB PE=3 SV=1 78 265 6.0E-14
sp|Q9I3W9|PDXB_PSEAE Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pdxB PE=1 SV=1 160 265 6.0E-14
sp|A6V8H9|PDXB_PSEA7 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=pdxB PE=3 SV=1 160 265 7.0E-14
sp|Q1QXV7|PDXB_CHRSD Erythronate-4-phosphate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pdxB PE=3 SV=1 78 316 7.0E-14
sp|B7UVK4|PDXB_PSEA8 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=pdxB PE=3 SV=1 160 265 7.0E-14
sp|Q02JM2|PDXB_PSEAB Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pdxB PE=3 SV=1 160 265 8.0E-14
sp|B0VDM7|PDXB_ACIBY Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=pdxB PE=3 SV=1 78 265 1.0E-13
sp|B7I5Z2|PDXB_ACIB5 Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=pdxB PE=3 SV=1 78 265 1.0E-13
sp|B7GY62|PDXB_ACIB3 Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=pdxB PE=3 SV=1 78 265 1.0E-13
sp|Q1LTA7|PDXB_BAUCH Erythronate-4-phosphate dehydrogenase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pdxB PE=3 SV=1 139 268 1.0E-13
sp|A5WHK7|PDXB_PSYWF Erythronate-4-phosphate dehydrogenase OS=Psychrobacter sp. (strain PRwf-1) GN=pdxB PE=3 SV=1 147 271 2.0E-13
sp|Q2SJQ9|PDXB_HAHCH Erythronate-4-phosphate dehydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=pdxB PE=3 SV=1 63 271 8.0E-13
sp|Q884R9|PDXB_PSESM Erythronate-4-phosphate dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pdxB PE=3 SV=1 78 265 1.0E-12
sp|P33677|FDH_PICAN Formate dehydrogenase OS=Pichia angusta GN=FMDH PE=3 SV=2 68 262 1.0E-12
sp|B4EZF9|PDXB_PROMH Erythronate-4-phosphate dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=pdxB PE=3 SV=1 62 271 2.0E-12
sp|Q48KQ3|PDXB_PSE14 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pdxB PE=3 SV=2 160 265 2.0E-12
sp|A3M810|PDXB_ACIBT Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pdxB PE=3 SV=2 78 265 4.0E-12
sp|A9KEY5|PDXB_COXBN Erythronate-4-phosphate dehydrogenase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pdxB PE=3 SV=1 47 268 4.0E-12
sp|B0VT23|PDXB_ACIBS Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=pdxB PE=3 SV=1 78 265 4.0E-12
sp|P0CF35|FDH2_YEAST Truncated formate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FDH2 PE=5 SV=1 142 265 6.0E-12
sp|Q83AR8|PDXB_COXBU Erythronate-4-phosphate dehydrogenase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pdxB PE=3 SV=2 47 268 7.0E-12
sp|A9NAQ7|PDXB_COXBR Erythronate-4-phosphate dehydrogenase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pdxB PE=3 SV=1 47 268 7.0E-12
sp|C5BR49|PDXB_TERTT Erythronate-4-phosphate dehydrogenase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pdxB PE=3 SV=1 147 271 8.0E-12
sp|Q5E452|PDXB_VIBF1 Erythronate-4-phosphate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pdxB PE=3 SV=1 77 265 9.0E-12
sp|B2HX89|PDXB_ACIBC Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=pdxB PE=3 SV=1 78 265 1.0E-11
sp|A1JL55|PDXB_YERE8 Erythronate-4-phosphate dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pdxB PE=3 SV=1 33 268 2.0E-11
sp|B4TQA6|PDXB_SALSV Erythronate-4-phosphate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B5RCJ5|PDXB_SALG2 Erythronate-4-phosphate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B5R3Q1|PDXB_SALEP Erythronate-4-phosphate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B5FPL4|PDXB_SALDC Erythronate-4-phosphate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|P60802|PDXB_SALTY Erythronate-4-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxB PE=1 SV=1 139 268 2.0E-11
sp|P60801|PDXB_SALTI Erythronate-4-phosphate dehydrogenase OS=Salmonella typhi GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|C0PZZ3|PDXB_SALPC Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|A9N474|PDXB_SALPB Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B4SZP2|PDXB_SALNS Erythronate-4-phosphate dehydrogenase OS=Salmonella newport (strain SL254) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B4TBN9|PDXB_SALHS Erythronate-4-phosphate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|Q57LY4|PDXB_SALCH Erythronate-4-phosphate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxB PE=3 SV=2 139 268 2.0E-11
sp|B5EZQ4|PDXB_SALA4 Erythronate-4-phosphate dehydrogenase OS=Salmonella agona (strain SL483) GN=pdxB PE=3 SV=1 139 268 2.0E-11
sp|B5FFP0|PDXB_VIBFM Erythronate-4-phosphate dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=pdxB PE=3 SV=1 63 265 2.0E-11
sp|A4VKJ1|PDXB_PSEU5 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=pdxB PE=3 SV=1 160 271 2.0E-11
sp|A8GH44|PDXB_SERP5 Erythronate-4-phosphate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=pdxB PE=3 SV=1 62 268 3.0E-11
sp|Q31IH6|PDXB_THICR Erythronate-4-phosphate dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxB PE=3 SV=1 141 268 3.0E-11
sp|Q21LK8|PDXB_SACD2 Erythronate-4-phosphate dehydrogenase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pdxB PE=3 SV=1 147 271 4.0E-11
sp|O23702|CTBP_ARATH C-terminal binding protein AN OS=Arabidopsis thaliana GN=AN PE=1 SV=1 73 311 4.0E-11
sp|B5BCH6|PDXB_SALPK Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=pdxB PE=3 SV=1 139 268 6.0E-11
sp|Q5PCV8|PDXB_SALPA Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxB PE=3 SV=1 139 268 6.0E-11
sp|B6EIW3|PDXB_ALISL Erythronate-4-phosphate dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=pdxB PE=3 SV=1 77 265 8.0E-11
sp|B1JGI0|PDXB_YERPY Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pdxB PE=3 SV=1 62 268 1.0E-10
sp|Q668W7|PDXB_YERPS Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pdxB PE=3 SV=2 62 268 1.0E-10
sp|A4TM66|PDXB_YERPP Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=pdxB PE=3 SV=2 62 268 1.0E-10
sp|Q1CHL8|PDXB_YERPN Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pdxB PE=3 SV=2 62 268 1.0E-10
sp|A9R7V0|PDXB_YERPG Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pdxB PE=3 SV=1 62 268 1.0E-10
sp|Q8D0U3|PDXB_YERPE Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis GN=pdxB PE=3 SV=2 62 268 1.0E-10
sp|B2K8H7|PDXB_YERPB Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pdxB PE=3 SV=1 62 268 1.0E-10
sp|Q1C676|PDXB_YERPA Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pdxB PE=3 SV=2 62 268 1.0E-10
sp|A7FGL9|PDXB_YERP3 Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pdxB PE=3 SV=1 62 268 1.0E-10
sp|Q7MV70|PDXB_PORGI Erythronate-4-phosphate dehydrogenase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pdxB PE=3 SV=2 62 268 2.0E-10
sp|Q492H2|PDXB_BLOPB Erythronate-4-phosphate dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pdxB PE=3 SV=1 63 268 4.0E-10
sp|C4LF16|PDXB_TOLAT Erythronate-4-phosphate dehydrogenase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pdxB PE=3 SV=1 62 271 4.0E-10
sp|Q5QUE2|PDXB_IDILO Erythronate-4-phosphate dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pdxB PE=3 SV=1 147 265 1.0E-09
sp|Q2VEQ7|DDH_HALMT D-2-hydroxyacid dehydrogenase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=ddh PE=1 SV=1 69 330 2.0E-09
sp|A0KLP0|PDXB_AERHH Erythronate-4-phosphate dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pdxB PE=3 SV=1 141 265 7.0E-09
sp|A4SNU1|PDXB_AERS4 Erythronate-4-phosphate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=pdxB PE=3 SV=1 78 265 1.0E-08
sp|Q02961|YP113_YEAST Putative 2-hydroxyacid dehydrogenase YPL113C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL113C PE=2 SV=1 131 267 2.0E-08
sp|Q5WXZ0|PDXB_LEGPL Erythronate-4-phosphate dehydrogenase OS=Legionella pneumophila (strain Lens) GN=pdxB PE=3 SV=1 63 265 3.0E-08
sp|A1SW94|PDXB_PSYIN Erythronate-4-phosphate dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=pdxB PE=3 SV=1 125 265 4.0E-08
sp|Q2NSH9|PDXB_SODGM Erythronate-4-phosphate dehydrogenase OS=Sodalis glossinidius (strain morsitans) GN=pdxB PE=3 SV=1 161 268 4.0E-08
sp|P53100|YGT5_YEAST Putative 2-hydroxyacid dehydrogenase YGL185C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL185C PE=1 SV=1 68 276 5.0E-08
sp|B5XNR7|PDXB_KLEP3 Erythronate-4-phosphate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=pdxB PE=3 SV=1 163 271 7.0E-08
sp|A8AI49|GHRA_CITK8 Glyoxylate/hydroxypyruvate reductase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ghrA PE=3 SV=1 59 265 8.0E-08
sp|Q47XK1|PDXB_COLP3 Erythronate-4-phosphate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pdxB PE=3 SV=1 1 265 9.0E-08
sp|A7MH63|PDXB_CROS8 Erythronate-4-phosphate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pdxB PE=3 SV=1 163 271 1.0E-07
sp|B5YVQ3|GHRA_ECO5E Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ghrA PE=3 SV=1 59 265 1.0E-07
sp|Q8X9K1|GHRA_ECO57 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O157:H7 GN=ghrA PE=3 SV=2 59 265 1.0E-07
sp|Q31Z89|GHRA_SHIBS Glyoxylate/hydroxypyruvate reductase A OS=Shigella boydii serotype 4 (strain Sb227) GN=ghrA PE=3 SV=2 59 265 1.0E-07
sp|B2TTN6|GHRA_SHIB3 Glyoxylate/hydroxypyruvate reductase A OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ghrA PE=3 SV=1 59 265 1.0E-07
sp|Q5ZX15|PDXB_LEGPH Erythronate-4-phosphate dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pdxB PE=3 SV=1 63 265 1.0E-07
sp|Q5X6I6|PDXB_LEGPA Erythronate-4-phosphate dehydrogenase OS=Legionella pneumophila (strain Paris) GN=pdxB PE=3 SV=1 63 265 1.0E-07
sp|B7NLA1|GHRA_ECO7I Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|B5YXW1|PDXB_ECO5E Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|Q8XCR0|PDXB_ECO57 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|Q0TJ41|GHRA_ECOL5 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|B7UP47|GHRA_ECO27 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|Q83QR1|PDXB_SHIFL Erythronate-4-phosphate dehydrogenase OS=Shigella flexneri GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|Q0T2G5|PDXB_SHIF8 Erythronate-4-phosphate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B1LIY1|GHRA_ECOSM Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|B1IV68|GHRA_ECOLC Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|Q1RDC8|GHRA_ECOUT Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain UTI89 / UPEC) GN=ghrA PE=3 SV=2 59 265 2.0E-07
sp|A1A9T1|GHRA_ECOK1 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O1:K1 / APEC GN=ghrA PE=3 SV=2 59 265 2.0E-07
sp|B7MIH3|GHRA_ECO45 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ghrA PE=3 SV=1 59 265 2.0E-07
sp|Q3YZP1|PDXB_SHISS Erythronate-4-phosphate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|Q31YD8|PDXB_SHIBS Erythronate-4-phosphate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B2TWA2|PDXB_SHIB3 Erythronate-4-phosphate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B6I4U8|PDXB_ECOSE Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain SE11) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|A8A2I9|PDXB_ECOHS Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B7M6K1|PDXB_ECO8A Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B7UFX8|PDXB_ECO27 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|Q32DL6|PDXB_SHIDS Erythronate-4-phosphate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxB PE=3 SV=1 62 271 2.0E-07
sp|B7LFE3|GHRA_ECO55 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain 55989 / EAEC) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|Q7N2B2|PDXB_PHOLL Erythronate-4-phosphate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pdxB PE=3 SV=1 166 268 3.0E-07
sp|Q3Z393|GHRA_SHISS Glyoxylate/hydroxypyruvate reductase A OS=Shigella sonnei (strain Ss046) GN=ghrA PE=3 SV=2 59 265 3.0E-07
sp|B6I9A9|GHRA_ECOSE Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain SE11) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|P75913|GHRA_ECOLI Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12) GN=ghrA PE=1 SV=2 59 265 3.0E-07
sp|B1X9E7|GHRA_ECODH Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12 / DH10B) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|C4ZRX4|GHRA_ECOBW Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|B7M907|GHRA_ECO8A Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O8 (strain IAI1) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|P05459|PDXB_ECOLI Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12) GN=pdxB PE=2 SV=2 192 271 3.0E-07
sp|B1X931|PDXB_ECODH Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=pdxB PE=3 SV=1 192 271 3.0E-07
sp|C4ZVL3|PDXB_ECOBW Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pdxB PE=3 SV=1 192 271 3.0E-07
sp|A7ZYY6|GHRA_ECOHS Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O9:H4 (strain HS) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|B7LBH4|PDXB_ECO55 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|B1IXM2|PDXB_ECOLC Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pdxB PE=3 SV=1 192 271 3.0E-07
sp|B7MTG4|GHRA_ECO81 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O81 (strain ED1a) GN=ghrA PE=3 SV=1 59 265 3.0E-07
sp|Q1R992|PDXB_ECOUT Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|A1ADG9|PDXB_ECOK1 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|B7MG84|PDXB_ECO45 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|B7LLF0|PDXB_ESCF3 Erythronate-4-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|B1LLS6|PDXB_ECOSM Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|Q8FFH2|PDXB_ECOL6 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxB PE=3 SV=1 62 271 3.0E-07
sp|B7N5T2|PDXB_ECOLU Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pdxB PE=3 SV=1 192 271 4.0E-07
sp|A7ZPD6|PDXB_ECO24 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pdxB PE=3 SV=1 192 271 4.0E-07
sp|C5B8N0|PDXB_EDWI9 Erythronate-4-phosphate dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=pdxB PE=3 SV=1 44 268 4.0E-07
sp|A9MJ55|PDXB_SALAR Erythronate-4-phosphate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pdxB PE=3 SV=1 163 268 8.0E-07
sp|A4WCV4|PDXB_ENT38 Erythronate-4-phosphate dehydrogenase OS=Enterobacter sp. (strain 638) GN=pdxB PE=3 SV=1 163 268 8.0E-07
sp|B7N3I0|GHRA_ECOLU Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ghrA PE=3 SV=1 59 265 8.0E-07
sp|A8ADQ9|PDXB_CITK8 Erythronate-4-phosphate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pdxB PE=3 SV=1 163 268 9.0E-07
sp|Q0TFC6|PDXB_ECOL5 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxB PE=3 SV=1 192 271 2.0E-06
sp|B7NP01|PDXB_ECO7I Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pdxB PE=3 SV=1 192 271 2.0E-06
sp|Q6D2N5|PDXB_PECAS Erythronate-4-phosphate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pdxB PE=3 SV=1 163 268 3.0E-06
sp|B7MXZ7|PDXB_ECO81 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=pdxB PE=3 SV=1 192 271 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0050661 NADP binding Yes
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6291
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3541 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1088
Ophiocordyceps kimflemingae Ophio5|18
Ophiocordyceps subramaniannii Hirsu2|8543

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3541
MRLHIFSAKPYDKQFLSAANSSFHLTLQFHDFPLNLDSVWLARGADAVCVFVNDSLPAPVMAILAQLNIKAILLR
CAGYNNVDLAAARAHSLVVANVPSYSPEGVAEFAVALIQTLNRRVHRAYNRVREANFSLTGLIGRTLHGKTVGII
GTGRIGLATVRIMRGFGCRVLAYDPFPDAHALLQAGGEYLDSLDALLPQCDIVSLHCPLTDSTRHIINPLSLAML
KPGAMLVNTSRGGLVDTNAVIDALKSKHLSGLALDVYEAEDSLFYEDHSADVVQDDAIMRLTTFHNVLVCGHQAF
FTQEALEEIAQCTLRNATEIAATGSCTNSLTKDPAIQRRGSFPVRTV*
Coding >OphauG2|3541
ATGCGTCTCCACATCTTCAGCGCCAAGCCCTACGACAAACAATTCCTCTCGGCCGCAAACTCGTCCTTCCACTTG
ACCCTCCAGTTCCACGACTTCCCTCTCAATCTCGACAGCGTTTGGCTCGCGCGTGGCGCCGATGCAGTCTGCGTC
TTTGTCAATGACTCTCTCCCTGCCCCCGTCATGGCCATTCTTGCACAACTAAACATCAAGGCCATTCTCCTCCGT
TGCGCGGGCTACAACAATGTCGACTTGGCCGCTGCCCGTGCCCATTCTCTCGTCGTTGCAAACGTGCCGTCGTAC
TCTCCAGAAGGCGTCGCTGAATTTGCAGTCGCCCTGATTCAGACTCTAAACCGCCGTGTGCACCGCGCCTACAAC
CGCGTGCGCGAGGCAAACTTTTCCCTCACGGGCTTGATTGGCCGTACCCTTCATGGCAAGACTGTCGGCATCATT
GGCACGGGGCGCATTGGCCTGGCCACTGTACGCATCATGCGCGGCTTTGGCTGCCGCGTCTTGGCCTATGACCCC
TTTCCTGATGCCCACGCCCTTCTTCAAGCCGGCGGCGAATATCTTGACTCGCTAGATGCCTTGCTGCCCCAATGC
GACATTGTCAGCCTCCACTGCCCGCTAACCGACTCTACTCGTCACATCATTAACCCACTCTCTCTCGCAATGCTT
AAACCCGGTGCCATGCTCGTCAATACCTCGCGCGGTGGCCTCGTCGACACAAACGCCGTTATTGACGCGCTCAAG
TCGAAGCATCTCAGTGGCCTTGCTCTCGATGTCTATGAGGCCGAGGACTCTCTCTTTTACGAGGACCACTCAGCC
GATGTCGTTCAAGACGACGCCATTATGCGCCTCACCACCTTTCACAATGTCTTGGTTTGCGGCCACCAAGCCTTC
TTTACCCAAGAAGCCCTCGAGGAAATCGCCCAGTGTACGCTGCGCAATGCAACCGAGATTGCCGCCACGGGATCC
TGTACAAACTCTTTGACCAAGGATCCTGCCATCCAACGCCGTGGCTCCTTTCCAGTTCGGACCGTCTAA
Transcript >OphauG2|3541
ATGCGTCTCCACATCTTCAGCGCCAAGCCCTACGACAAACAATTCCTCTCGGCCGCAAACTCGTCCTTCCACTTG
ACCCTCCAGTTCCACGACTTCCCTCTCAATCTCGACAGCGTTTGGCTCGCGCGTGGCGCCGATGCAGTCTGCGTC
TTTGTCAATGACTCTCTCCCTGCCCCCGTCATGGCCATTCTTGCACAACTAAACATCAAGGCCATTCTCCTCCGT
TGCGCGGGCTACAACAATGTCGACTTGGCCGCTGCCCGTGCCCATTCTCTCGTCGTTGCAAACGTGCCGTCGTAC
TCTCCAGAAGGCGTCGCTGAATTTGCAGTCGCCCTGATTCAGACTCTAAACCGCCGTGTGCACCGCGCCTACAAC
CGCGTGCGCGAGGCAAACTTTTCCCTCACGGGCTTGATTGGCCGTACCCTTCATGGCAAGACTGTCGGCATCATT
GGCACGGGGCGCATTGGCCTGGCCACTGTACGCATCATGCGCGGCTTTGGCTGCCGCGTCTTGGCCTATGACCCC
TTTCCTGATGCCCACGCCCTTCTTCAAGCCGGCGGCGAATATCTTGACTCGCTAGATGCCTTGCTGCCCCAATGC
GACATTGTCAGCCTCCACTGCCCGCTAACCGACTCTACTCGTCACATCATTAACCCACTCTCTCTCGCAATGCTT
AAACCCGGTGCCATGCTCGTCAATACCTCGCGCGGTGGCCTCGTCGACACAAACGCCGTTATTGACGCGCTCAAG
TCGAAGCATCTCAGTGGCCTTGCTCTCGATGTCTATGAGGCCGAGGACTCTCTCTTTTACGAGGACCACTCAGCC
GATGTCGTTCAAGACGACGCCATTATGCGCCTCACCACCTTTCACAATGTCTTGGTTTGCGGCCACCAAGCCTTC
TTTACCCAAGAAGCCCTCGAGGAAATCGCCCAGTGTACGCTGCGCAATGCAACCGAGATTGCCGCCACGGGATCC
TGTACAAACTCTTTGACCAAGGATCCTGCCATCCAACGCCGTGGCTCCTTTCCAGTTCGGACCGTCTAA
Gene >OphauG2|3541
ATGCGTCTCCACATCTTCAGCGCCAAGCCCTACGACAAACAATTCCTCTCGGCCGCAAACTCGTCCTTCCACTTG
ACCCTCCAGTTCCACGACTTCCCTCTCAATCTCGACAGCGTTTGGCTCGCGCGTGGCGCCGATGCAGTCTGCGTC
TTTGTCAATGACTCTCTCCCTGCCCCCGTCATGGCCATTCTTGCACAACTAAACATCAAGGCCATTCTCCTCCGT
TGCGCGGGCTACAACAATGTCGACTTGGCCGCTGCCCGTGCCCATTCTCTCGTCGTTGCAAACGTGCCGTCGTAC
TCTCCAGAAGGCGTCGCTGAATTTGCAGTCGCCCTGATTCAGACTCTAAACCGCCGTGTGCACCGCGCCTACAAC
CGCGTGCGCGAGGCAAACTTTTCCCTCACGGGCTTGATTGGCCGTACCCTTCATGGCAAGACTGTCGGCATCATT
GGCACGGGGCGCATTGGCCTGGCCACTGTACGCATCATGCGCGGCTTTGGCTGCCGCGTCTTGGCCTATGACCCC
TTTCCTGATGCCCACGCCCTTCTTCAAGCCGGCGGCGAATATCTTGACTCGCTAGATGCCTTGCTGCCCCAATGC
GACATTGTCAGCCTCCACTGCCCGCTAACCGACTCTACTCGTCACATCATTAACCCACTCTCTCTCGCAATGCTT
AAACCCGGTGCCATGCTCGTCAATACCTCGCGCGGTGGCCTCGTCGACACAAACGCCGTTATTGACGCGCTCAAG
TCGAAGCATCTCAGTGGCCTTGCTCTCGATGTCTATGAGGCCGAGGACTCTCTCTTTTACGAGGACCACTCAGCC
GATGTCGTTCAAGACGACGCCATTATGCGCCTCACCACCTTTCACAATGTCTTGGTTTGCGGCCACCAAGCCTTC
TTTACCCAAGAAGCCCTCGAGGAAATCGCCCAGTGTACGCTGCGCAATGCAACCGAGATTGCCGCCACGGGATCC
TGTACAAACTCTTTGACCAAGGATCCTGCCATCCAACGCCGTGGCTCCTTTCCAGTTCGGACCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail