Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3518
Gene name
LocationContig_27:14464..15169
Strand+
Gene length (bp)705
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03931 Skp1_POZ Skp1 family, tetramerisation domain 7.9E-07 8 69

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q751F9|ELOC_ASHGO Elongin-C OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ELC1 PE=3 SV=1 4 101 5.0E-21
sp|P83941|ELOC_RAT Transcription elongation factor B polypeptide 1 OS=Rattus norvegicus GN=Tceb1 PE=1 SV=1 8 99 3.0E-19
sp|P83940|ELOC_MOUSE Transcription elongation factor B polypeptide 1 OS=Mus musculus GN=Tceb1 PE=1 SV=1 8 99 3.0E-19
sp|Q15369|ELOC_HUMAN Transcription elongation factor B polypeptide 1 OS=Homo sapiens GN=TCEB1 PE=1 SV=1 8 99 3.0E-19
sp|Q2KII4|ELOC_BOVIN Transcription elongation factor B polypeptide 1 OS=Bos taurus GN=TCEB1 PE=3 SV=1 8 99 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q751F9|ELOC_ASHGO Elongin-C OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ELC1 PE=3 SV=1 4 101 5.0E-21
sp|P83941|ELOC_RAT Transcription elongation factor B polypeptide 1 OS=Rattus norvegicus GN=Tceb1 PE=1 SV=1 8 99 3.0E-19
sp|P83940|ELOC_MOUSE Transcription elongation factor B polypeptide 1 OS=Mus musculus GN=Tceb1 PE=1 SV=1 8 99 3.0E-19
sp|Q15369|ELOC_HUMAN Transcription elongation factor B polypeptide 1 OS=Homo sapiens GN=TCEB1 PE=1 SV=1 8 99 3.0E-19
sp|Q2KII4|ELOC_BOVIN Transcription elongation factor B polypeptide 1 OS=Bos taurus GN=TCEB1 PE=3 SV=1 8 99 3.0E-19
sp|Q9USX9|ELOC_SCHPO Elongin-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elc1 PE=3 SV=1 7 99 5.0E-19
sp|Q03071|ELOC_YEAST Elongin-C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELC1 PE=1 SV=1 8 101 7.0E-16
sp|Q54Q05|ELOC_DICDI Transcription elongation factor B polypeptide 1 OS=Dictyostelium discoideum GN=tceb1 PE=3 SV=1 11 99 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:1901575 organic substance catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044248 cellular catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3518 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6538
Ophiocordyceps camponoti-floridani Ophcf2|06638
Ophiocordyceps camponoti-rufipedis Ophun1|6871
Ophiocordyceps kimflemingae Ophio5|3734
Ophiocordyceps subramaniannii Hirsu2|6449

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3518
MDKTLDQYVTLVAADGLEFVVLRDAAMVSPIVKGMLDPRSQFVEAKDARCVFEEISSPVLDKVVEYFQYWYRYRN
SEDVPDMDIPVELCLELLAAADFLGLDQANLNIK*
Coding >OphauG2|3518
ATGGACAAGACTTTGGACCAGTACGTGACCCTGGTGGCGGCCGATGGGCTCGAGTTTGTTGTGCTGCGCGACGCA
GCCATGGTGAGCCCTATTGTCAAGGGCATGCTGGATCCTAGGAGCCAATTCGTCGAGGCCAAGGATGCGCGCTGT
GTCTTTGAGGAAATCAGCAGCCCGGTGCTCGACAAAGTGGTCGAGTACTTCCAATACTGGTATCGCTATCGTAAT
AGCGAGGACGTGCCCGACATGGACATTCCCGTCGAGCTATGTCTCGAGCTGCTCGCCGCTGCCGATTTTCTTGGC
TTGGATCAAGCCAATTTAAACATCAAGTGA
Transcript >OphauG2|3518
ATGGACAAGACTTTGGACCAGTACGTGACCCTGGTGGCGGCCGATGGGCTCGAGTTTGTTGTGCTGCGCGACGCA
GCCATGGTGAGCCCTATTGTCAAGGGCATGCTGGATCCTAGGAGCCAATTCGTCGAGGCCAAGGATGCGCGCTGT
GTCTTTGAGGAAATCAGCAGCCCGGTGCTCGACAAAGTGGTCGAGTACTTCCAATACTGGTATCGCTATCGTAAT
AGCGAGGACGTGCCCGACATGGACATTCCCGTCGAGCTATGTCTCGAGCTGCTCGCCGCTGCCGATTTTCTTGGC
TTGGATCAAGCCAATTTAAACATCAAGTGA
Gene >OphauG2|3518
ATGGACAAGACTTTGGACCAGTACGTGACCCTGGTGGCGGCCGATGGGCTCGAGTTTGTTGTGCTGCGCGACGCA
GCCATGGTGAGCCCTATTGTCAAGGGCATGCTGGATCCTAGGAGTGCGTCGGCCCTGCTGCTGTCTGCTGTCTGC
TGCACGTCTTGCTCACTGTTGCAGGCCAATTCGTCGAGGCCAAGGATGCGCGCTGTGTCTTTGAGGAAATCAGGT
GAGCCGCGTCGACGCATCCATGCATCCTGTCTGTTCTTGGCCCGCCTTGGCCGCATCTAGACATGGCTGGCACCA
AGCTCCATGATGATATATGAGATGCCCGACAGAGCCGCTCTCATGGCTCTGGCTGACCATGATCAATATCTACAC
TACACTTGACCTGACCGACTCTGGCTGCCGCTGCCGTCCCCCCTCGTGCCCCTTCCCCCGTTTGCCTTGGCTTGT
GCCCTCGAGCTGACAGACAATCAACAGCAGCCCGGTGCTCGACAAAGTGGTCGAGTACTTCCAATACTGGTATCG
CTATCGTAATAGCGAGGACGTGCCCGACATGGACATTCCCGTCGAGCTATGTCTCGAGCTGCTCGCCGCTGCCGA
TTTTCTTGGCTTGGATCAGTAAGGCTGACTGACTCTAAGCAAAACGTGGTTTGAAAAGCCCCGTCCTGACTAATT
TGACGCAGAGCCAATTTAAACATCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail