Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3509
Gene name
LocationContig_269:8772..12212
Strand+
Gene length (bp)3440
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04097 Nic96 Nup93/Nic96 2.9E-202 428 1099

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 107 1107 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 481 1101 7.0E-93
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 479 1107 5.0E-76
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 175 1101 2.0E-54
sp|Q8BJ71|NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus GN=Nup93 PE=1 SV=1 416 1092 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 107 1107 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 481 1101 7.0E-93
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 479 1107 5.0E-76
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 175 1101 2.0E-54
sp|Q8BJ71|NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus GN=Nup93 PE=1 SV=1 416 1092 5.0E-29
sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup93 OS=Pongo abelii GN=NUP93 PE=2 SV=2 416 1092 5.0E-29
sp|Q66HC5|NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus GN=Nup93 PE=1 SV=1 416 1092 1.0E-28
sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 416 1092 2.0E-28
sp|A5PJZ5|NUP93_BOVIN Nuclear pore complex protein Nup93 OS=Bos taurus GN=NUP93 PE=2 SV=1 471 1092 5.0E-28
sp|Q7ZU29|NUP93_DANRE Nuclear pore complex protein Nup93 OS=Danio rerio GN=dye PE=2 SV=1 474 1072 1.0E-27
sp|Q6NX12|NUP93_XENTR Nuclear pore complex protein Nup93 OS=Xenopus tropicalis GN=nup93 PE=2 SV=1 474 1056 1.0E-27
sp|Q7ZX96|NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis GN=nup93 PE=2 SV=1 476 1056 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0003674 molecular_function No
GO:0005198 structural molecule activity No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3851
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3509 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1382
Ophiocordyceps camponoti-floridani Ophcf2|00480
Ophiocordyceps camponoti-rufipedis Ophun1|4065
Ophiocordyceps kimflemingae Ophio5|7084
Ophiocordyceps subramaniannii Hirsu2|7623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3509
MSVFGQPSFSLGGGLGQNQQAGSGLMGASQASGQATQPQQQQGSMGLGAGGGTATTNSGEGGLFGLFGGARPDQQ
QQQQQQQQQQQQQANTAFGANTAFATNATLGATSLNQQPQQNANSTFGGGSLGGGLLGSSVLAPASQAQPPQSQQ
PAGAYFDSLFAKAQKNGGARSTVDELPTLELGVGDLRHRLRKLQSNANEKLLDGKAHYLLAASGVDPGVAARDLD
MLHVKGGRVERAHGYAPTEIDVETYLANLQAKTTLDMINDSMAHTSRNFDKFLQDHISAEWDDQRKRIYEHFGIK
IPQEAAPGSRESQSAFGRSRRSKGQGSQSRAARSTMFGTSALQRSVIGTPSRIGAHETEFSDIETSADGLGALKS
RSVTEDAGFRDRQAKLAEKVRGLNAARLDRAPYPILTELAQVELKNHQVHAPHVVEAYRALVEIVGELPCDEAAL
TQPPPCERQFAKMYLDENTNSPQAVEMRRRILRGSTQFLEQQFMREVELLIAKFPHDARLGGLPDVKSKIKAYIR
LRAARRDLVPDKTELQLLQGEYVWAVIFYLLRAGQIDAAVSYVAEKMAQLRGIDRMFATYLNLYAASGERRITNR
QLQDRCTNEYFQRSRGAQDKAIDPFRMACYKVLGRVELSNRNLDGLTTDINDWIWLQFTLAREGDKSLDMAGESY
GLVELQASVREIGLKHFPKGNSDGRDNNAFGMFFYLQILAGLFEDAIAYLYPFSYIDAVHFALALTYYGLLRPSD
PLSASNQLRSLSVKGLPQINFGRMMGYYTRDFRAADVVSAVDYLVLISLNRDLDGEAGRRQSSLCHEALRDLVLE
TREFSKLIGDITPDGHGIRGVIQERVPLLELDHDDDFVRALTLQAAGFADENGRTTDAVLLYHLAAEYDTVVAIV
SRSLSEAISMQLGEDPLRLVPAKPRVDGTVDKEQQPQGSSLSLAAIDDPVELARTMMTMYDRDVNFYGNIQDNNK
TACRVLLQMSSIKKLVEAGSWALALDKIKLLEILPLAAEGDASTVRAYAARFSGLSQPVAINVPNLLMWTVLCCV
RQREQLTNGRYSGNEGTRRMLLDQLRQITLDLTAYTSQLRYRFPPHLHEALARASAE*
Coding >OphauG2|3509
ATGTCTGTCTTTGGACAGCCGTCGTTTTCGCTTGGGGGCGGCCTCGGCCAGAATCAGCAAGCGGGCAGTGGGCTG
ATGGGGGCTTCTCAGGCCAGTGGTCAAGCGACACAACCCCAGCAACAGCAGGGCTCCATGGGTCTCGGTGCTGGA
GGCGGCACAGCGACGACAAACAGCGGCGAGGGCGGCCTCTTTGGGTTGTTTGGGGGAGCCAGGCCGGATCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAACAGGCAAACACAGCTTTTGGGGCAAATACAGCCTTTGCA
ACAAACGCAACCTTGGGCGCCACCTCGCTCAACCAGCAACCACAGCAAAATGCAAATTCCACGTTCGGAGGCGGC
TCGCTTGGCGGAGGCCTGCTTGGATCAAGTGTTCTGGCGCCAGCCTCGCAGGCTCAGCCGCCGCAGTCGCAACAG
CCCGCGGGAGCCTACTTTGACAGCCTGTTTGCCAAGGCACAAAAGAATGGCGGCGCCAGGTCGACAGTCGACGAG
CTTCCAACCTTGGAGCTCGGCGTCGGAGACCTTCGCCACAGGCTGCGTAAGCTCCAGTCCAATGCAAACGAGAAG
CTTTTGGATGGCAAGGCACACTATCTACTGGCGGCATCCGGCGTCGACCCCGGCGTAGCCGCCCGAGACCTGGAC
ATGCTGCATGTCAAGGGCGGCCGTGTTGAGCGAGCTCACGGCTATGCACCGACCGAAATCGACGTAGAGACATAT
CTCGCCAACCTACAGGCCAAGACGACTCTGGACATGATCAATGACAGCATGGCACACACTTCGCGCAACTTTGAC
AAATTCCTCCAAGACCATATATCTGCCGAGTGGGACGACCAGCGCAAGCGAATCTACGAGCACTTTGGCATCAAG
ATTCCACAAGAAGCAGCGCCAGGAAGCCGTGAGTCGCAGTCTGCATTTGGGCGCTCTCGCCGCAGCAAAGGCCAA
GGCAGCCAATCTCGCGCCGCCCGCAGCACCATGTTTGGCACTTCGGCGCTACAACGCTCCGTCATCGGCACTCCC
AGCCGCATTGGTGCCCACGAGACCGAGTTTTCCGACATTGAGACTTCAGCCGACGGCCTGGGCGCTCTCAAGTCG
CGCAGCGTGACTGAAGACGCCGGCTTTCGTGACAGACAGGCCAAGCTGGCAGAAAAGGTGCGCGGCCTCAACGCG
GCTCGCCTGGACAGGGCGCCCTACCCCATCTTGACCGAGTTGGCCCAAGTGGAACTAAAAAACCATCAAGTCCAC
GCGCCACACGTGGTGGAAGCCTATCGGGCCCTTGTCGAGATTGTCGGCGAGCTGCCCTGCGATGAGGCGGCACTG
ACGCAGCCGCCCCCGTGTGAGCGCCAATTCGCAAAAATGTACCTCGACGAAAACACAAACTCTCCCCAAGCTGTC
GAGATGAGAAGGCGCATTCTCAGGGGCTCCACCCAGTTTCTCGAGCAACAGTTTATGCGCGAGGTGGAGCTGCTC
ATTGCCAAGTTTCCCCACGATGCCAGGCTGGGAGGCCTGCCCGATGTCAAGAGCAAGATCAAGGCCTACATCAGG
CTGCGGGCAGCCCGAAGGGACCTGGTGCCGGACAAGACGGAGCTGCAGCTGCTGCAAGGCGAGTACGTCTGGGCC
GTCATTTTCTACCTGCTGCGCGCTGGCCAGATTGATGCCGCAGTTTCCTACGTGGCGGAAAAGATGGCTCAGCTC
CGCGGCATCGACCGCATGTTTGCCACCTACCTCAACCTCTATGCCGCCAGCGGTGAGCGCCGCATTACCAACCGC
CAGTTGCAAGACCGCTGCACAAACGAGTATTTCCAGCGCTCGCGCGGCGCCCAGGACAAGGCCATTGACCCCTTT
CGCATGGCCTGCTACAAAGTCCTGGGCCGCGTTGAGCTCAGCAACCGCAATCTCGACGGCCTCACAACCGACATC
AACGACTGGATCTGGCTGCAGTTTACTCTTGCCCGTGAGGGAGACAAGAGCCTTGACATGGCCGGCGAGTCGTAT
GGCTTGGTGGAGCTGCAGGCCAGCGTGCGCGAAATCGGACTCAAGCACTTCCCCAAGGGCAACTCGGACGGCCGG
GATAATAACGCCTTTGGCATGTTTTTCTACTTGCAGATCCTGGCCGGGCTATTCGAGGATGCCATTGCCTACCTC
TACCCCTTTTCATACATTGACGCCGTCCATTTTGCCCTGGCCCTCACCTACTACGGCTTGCTTCGTCCCAGCGAT
CCGCTCTCAGCCTCCAACCAATTACGCAGCCTCAGCGTCAAGGGACTGCCGCAGATCAACTTTGGCCGCATGATG
GGCTACTACACGCGTGACTTTCGCGCCGCCGATGTCGTGTCGGCTGTCGACTACTTGGTCCTCATCTCGCTCAAT
CGCGACCTTGACGGCGAGGCCGGACGGCGTCAGAGCAGCCTATGCCATGAGGCATTGCGCGACTTGGTCCTCGAG
ACGCGTGAGTTTAGCAAGCTGATTGGCGACATTACCCCCGACGGCCACGGCATCCGTGGCGTCATCCAGGAGCGT
GTCCCGCTCCTGGAACTGGACCACGATGACGACTTTGTTCGCGCACTGACGCTGCAAGCCGCCGGCTTCGCCGAC
GAGAATGGACGGACAACAGACGCCGTACTGCTCTATCACCTTGCAGCCGAGTACGACACAGTTGTGGCCATTGTC
AGCCGTTCTCTCAGCGAGGCCATTTCCATGCAGCTTGGCGAGGATCCGTTGCGCCTCGTGCCCGCCAAGCCGCGC
GTTGACGGCACGGTGGACAAGGAGCAACAGCCACAAGGCAGCAGTCTCAGCCTCGCCGCCATTGACGATCCCGTC
GAGCTGGCGCGCACCATGATGACCATGTACGATCGCGACGTCAACTTTTACGGAAACATCCAAGACAACAACAAG
ACGGCGTGCCGAGTCCTGCTTCAAATGAGCAGCATTAAAAAGCTAGTCGAGGCTGGTTCCTGGGCTTTAGCTCTT
GATAAGATCAAGTTGCTTGAAATCCTGCCCCTGGCTGCTGAAGGCGACGCGAGCACAGTGCGCGCCTATGCCGCC
CGCTTCTCAGGCCTCTCTCAGCCCGTCGCCATCAATGTGCCAAATCTACTCATGTGGACTGTCCTGTGTTGCGTC
AGACAGCGCGAGCAGCTTACCAATGGCCGATATAGCGGCAACGAGGGCACACGCCGCATGCTCCTTGATCAACTC
AGGCAAATAACGCTCGATTTGACGGCATACACGAGCCAGCTGCGATATCGCTTCCCGCCGCATTTGCACGAGGCG
CTGGCCAGGGCTTCGGCAGAGTAA
Transcript >OphauG2|3509
ATGTCTGTCTTTGGACAGCCGTCGTTTTCGCTTGGGGGCGGCCTCGGCCAGAATCAGCAAGCGGGCAGTGGGCTG
ATGGGGGCTTCTCAGGCCAGTGGTCAAGCGACACAACCCCAGCAACAGCAGGGCTCCATGGGTCTCGGTGCTGGA
GGCGGCACAGCGACGACAAACAGCGGCGAGGGCGGCCTCTTTGGGTTGTTTGGGGGAGCCAGGCCGGATCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAACAGGCAAACACAGCTTTTGGGGCAAATACAGCCTTTGCA
ACAAACGCAACCTTGGGCGCCACCTCGCTCAACCAGCAACCACAGCAAAATGCAAATTCCACGTTCGGAGGCGGC
TCGCTTGGCGGAGGCCTGCTTGGATCAAGTGTTCTGGCGCCAGCCTCGCAGGCTCAGCCGCCGCAGTCGCAACAG
CCCGCGGGAGCCTACTTTGACAGCCTGTTTGCCAAGGCACAAAAGAATGGCGGCGCCAGGTCGACAGTCGACGAG
CTTCCAACCTTGGAGCTCGGCGTCGGAGACCTTCGCCACAGGCTGCGTAAGCTCCAGTCCAATGCAAACGAGAAG
CTTTTGGATGGCAAGGCACACTATCTACTGGCGGCATCCGGCGTCGACCCCGGCGTAGCCGCCCGAGACCTGGAC
ATGCTGCATGTCAAGGGCGGCCGTGTTGAGCGAGCTCACGGCTATGCACCGACCGAAATCGACGTAGAGACATAT
CTCGCCAACCTACAGGCCAAGACGACTCTGGACATGATCAATGACAGCATGGCACACACTTCGCGCAACTTTGAC
AAATTCCTCCAAGACCATATATCTGCCGAGTGGGACGACCAGCGCAAGCGAATCTACGAGCACTTTGGCATCAAG
ATTCCACAAGAAGCAGCGCCAGGAAGCCGTGAGTCGCAGTCTGCATTTGGGCGCTCTCGCCGCAGCAAAGGCCAA
GGCAGCCAATCTCGCGCCGCCCGCAGCACCATGTTTGGCACTTCGGCGCTACAACGCTCCGTCATCGGCACTCCC
AGCCGCATTGGTGCCCACGAGACCGAGTTTTCCGACATTGAGACTTCAGCCGACGGCCTGGGCGCTCTCAAGTCG
CGCAGCGTGACTGAAGACGCCGGCTTTCGTGACAGACAGGCCAAGCTGGCAGAAAAGGTGCGCGGCCTCAACGCG
GCTCGCCTGGACAGGGCGCCCTACCCCATCTTGACCGAGTTGGCCCAAGTGGAACTAAAAAACCATCAAGTCCAC
GCGCCACACGTGGTGGAAGCCTATCGGGCCCTTGTCGAGATTGTCGGCGAGCTGCCCTGCGATGAGGCGGCACTG
ACGCAGCCGCCCCCGTGTGAGCGCCAATTCGCAAAAATGTACCTCGACGAAAACACAAACTCTCCCCAAGCTGTC
GAGATGAGAAGGCGCATTCTCAGGGGCTCCACCCAGTTTCTCGAGCAACAGTTTATGCGCGAGGTGGAGCTGCTC
ATTGCCAAGTTTCCCCACGATGCCAGGCTGGGAGGCCTGCCCGATGTCAAGAGCAAGATCAAGGCCTACATCAGG
CTGCGGGCAGCCCGAAGGGACCTGGTGCCGGACAAGACGGAGCTGCAGCTGCTGCAAGGCGAGTACGTCTGGGCC
GTCATTTTCTACCTGCTGCGCGCTGGCCAGATTGATGCCGCAGTTTCCTACGTGGCGGAAAAGATGGCTCAGCTC
CGCGGCATCGACCGCATGTTTGCCACCTACCTCAACCTCTATGCCGCCAGCGGTGAGCGCCGCATTACCAACCGC
CAGTTGCAAGACCGCTGCACAAACGAGTATTTCCAGCGCTCGCGCGGCGCCCAGGACAAGGCCATTGACCCCTTT
CGCATGGCCTGCTACAAAGTCCTGGGCCGCGTTGAGCTCAGCAACCGCAATCTCGACGGCCTCACAACCGACATC
AACGACTGGATCTGGCTGCAGTTTACTCTTGCCCGTGAGGGAGACAAGAGCCTTGACATGGCCGGCGAGTCGTAT
GGCTTGGTGGAGCTGCAGGCCAGCGTGCGCGAAATCGGACTCAAGCACTTCCCCAAGGGCAACTCGGACGGCCGG
GATAATAACGCCTTTGGCATGTTTTTCTACTTGCAGATCCTGGCCGGGCTATTCGAGGATGCCATTGCCTACCTC
TACCCCTTTTCATACATTGACGCCGTCCATTTTGCCCTGGCCCTCACCTACTACGGCTTGCTTCGTCCCAGCGAT
CCGCTCTCAGCCTCCAACCAATTACGCAGCCTCAGCGTCAAGGGACTGCCGCAGATCAACTTTGGCCGCATGATG
GGCTACTACACGCGTGACTTTCGCGCCGCCGATGTCGTGTCGGCTGTCGACTACTTGGTCCTCATCTCGCTCAAT
CGCGACCTTGACGGCGAGGCCGGACGGCGTCAGAGCAGCCTATGCCATGAGGCATTGCGCGACTTGGTCCTCGAG
ACGCGTGAGTTTAGCAAGCTGATTGGCGACATTACCCCCGACGGCCACGGCATCCGTGGCGTCATCCAGGAGCGT
GTCCCGCTCCTGGAACTGGACCACGATGACGACTTTGTTCGCGCACTGACGCTGCAAGCCGCCGGCTTCGCCGAC
GAGAATGGACGGACAACAGACGCCGTACTGCTCTATCACCTTGCAGCCGAGTACGACACAGTTGTGGCCATTGTC
AGCCGTTCTCTCAGCGAGGCCATTTCCATGCAGCTTGGCGAGGATCCGTTGCGCCTCGTGCCCGCCAAGCCGCGC
GTTGACGGCACGGTGGACAAGGAGCAACAGCCACAAGGCAGCAGTCTCAGCCTCGCCGCCATTGACGATCCCGTC
GAGCTGGCGCGCACCATGATGACCATGTACGATCGCGACGTCAACTTTTACGGAAACATCCAAGACAACAACAAG
ACGGCGTGCCGAGTCCTGCTTCAAATGAGCAGCATTAAAAAGCTAGTCGAGGCTGGTTCCTGGGCTTTAGCTCTT
GATAAGATCAAGTTGCTTGAAATCCTGCCCCTGGCTGCTGAAGGCGACGCGAGCACAGTGCGCGCCTATGCCGCC
CGCTTCTCAGGCCTCTCTCAGCCCGTCGCCATCAATGTGCCAAATCTACTCATGTGGACTGTCCTGTGTTGCGTC
AGACAGCGCGAGCAGCTTACCAATGGCCGATATAGCGGCAACGAGGGCACACGCCGCATGCTCCTTGATCAACTC
AGGCAAATAACGCTCGATTTGACGGCATACACGAGCCAGCTGCGATATCGCTTCCCGCCGCATTTGCACGAGGCG
CTGGCCAGGGCTTCGGCAGAGTAA
Gene >OphauG2|3509
ATGTCTGTCTTTGGACAGCCGTCGTTTTCGCTTGGGGGCGGCCTCGGCCAGAATCAGCAAGCGGGCAGTGGGCTG
ATGGGTGCGGCCCCAGCATCAAGCTATTCGTCCATGGCTAACTGGTGCAATAGGGGCTTCTCAGGCCAGTGGTCA
AGCGACACAACCCCAGCAACAGCAGGGCTCCATGGGTCTCGGTGCTGGAGGCGGCACAGCGACGACAAACAGCGG
CGAGGGCGGCCTCTTTGGGTTGTTTGGGGGAGCCAGGCCGGATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACA
GCAACAGCAACAGGCAAACACAGCTTTTGGGGCAAATACAGCCTTTGCAACAAACGCAACCTTGGGCGCCACCTC
GCTCAACCAGCAACCACAGCAAAATGCAAATTCCACGTTCGGAGGCGGCTCGCTTGGCGGAGGCCTGCTTGGATC
AAGTGTTCTGGCGCCAGCCTCGCAGGCTCAGCCGCCGCAGTCGCAACAGCCCGCGGGAGCCTACTTTGACAGCCT
GTTTGCCAAGGCACAAAAGAATGGCGGCGCCAGGTCGACAGTCGACGAGCTTCCAACCTTGGAGCTCGGCGTCGG
AGACCTTCGCCACAGGCTGCGTAAGCTCCAGTCCAATGCAAACGAGAAGCTTTTGGATGGCAAGGCACACTATCT
ACTGGCGGCATCCGGCGTCGACCCCGGCGTAGCCGCCCGAGACCTGGACATGCTGCATGTCAAGGGCGGCCGTGT
TGAGCGAGCTCACGGCTATGCACCGACCGAAATCGACGTAGAGACATATCTCGCCAACCTACAGGCCAAGACGAC
TCTGGACATGATCAATGACAGCATGGCACACACTTCGCGCAACTTTGACAAATTCCTCCAAGACCATATATCTGC
CGAGTGGGACGACCAGCGCAAGCGAATCTACGAGCACTTTGGCATCAAGATTCCACAAGAAGCAGCGCCAGGAAG
CCGTGAGTCGCAGTCTGCATTTGGGCGCTCTCGCCGCAGCAAAGGCCAAGGCAGCCAATCTCGCGCCGCCCGCAG
CACCATGTTTGGCACTTCGGCGCTACAACGCTCCGTCATCGGCACTCCCAGCCGCATTGGTGCCCACGAGACCGA
GTTTTCCGACATTGAGACTTCAGCCGACGGCCTGGGCGCTCTCAAGTCGCGCAGCGTGACTGAAGACGCCGGCTT
TCGTGACAGACAGGCCAAGCTGGCAGAAAAGGTGCGCGGCCTCAACGCGGCTCGCCTGGACAGGGCGCCCTACCC
CATCTTGACCGAGTTGGCCCAAGTGGAACTAAAAAACCATCAAGTCCACGCGCCACACGTGGTGGAAGCCTATCG
GGCCCTTGTCGAGATTGTCGGCGAGCTGCCCTGCGATGAGGCGGCACTGACGCAGCCGCCCCCGTGTGAGCGCCA
ATTCGCAAAAATGTACCTCGACGAAAACACAAACTCTCCCCAAGCTGTCGAGATGAGAAGGCGCATTCTCAGGGG
CTCCACCCAGTTTCTCGAGCAACAGTTTATGCGCGAGGTGGAGCTGCTCATTGCCAAGTTTCCCCACGATGCCAG
GCTGGGAGGCCTGCCCGATGTCAAGAGCAAGATCAAGGCCTACATCAGGCTGCGGGCAGCCCGAAGGGACCTGGT
GCCGGACAAGACGGAGCTGCAGCTGCTGCAAGGCGAGTACGTCTGGGCCGTCATTTTCTACCTGCTGCGCGCTGG
CCAGATTGATGCCGCAGTTTCCTACGTGGCGGAAAAGATGGCTCAGCTCCGCGGCATCGACCGCATGTTTGCCAC
CTACCTCAACCTCTATGCCGCCAGCGGTGAGCGCCGCATTACCAACCGCCAGTTGCAAGACCGCTGCACAAACGA
GTATTTCCAGCGCTCGCGCGGCGCCCAGGACAAGGCCATTGACCCCTTTCGCATGGCCTGCTACAAAGTCCTGGG
CCGCGTTGAGCTCAGCAACCGCAATCTCGACGGCCTCACAACCGACATCAACGACTGGATCTGGCTGCAGTTTAC
TCTTGCCCGTGAGGGAGACAAGAGCCTTGACATGGCCGGCGAGTCGTATGGCTTGGTGGAGCTGCAGGCCAGCGT
GCGCGAAATCGGACTCAAGCACTTCCCCAAGGGCAACTCGGACGGCCGGGATAATAACGCCTTTGGCATGTTTTT
CTACTTGCAGATCCTGGCCGGGCTATTCGAGGATGCCATTGCCTACCTCTACCCCTTTTCATACATTGACGCCGT
CCATTTTGCCCTGGCCCTCACCTACTACGGCTTGCTTCGTCCCAGCGATCCGCTCTCAGCCTCCAACCAATTACG
CAGCCTCAGCGTCAAGGGACTGCCGCAGATCAACTTTGGCCGCATGATGGGCTACTACACGCGTGACTTTCGCGC
CGCCGATGTCGTGTCGGCTGTCGACTACTTGGTCCTCATCTCGCTCAATCGCGACCTTGACGGCGAGGCCGGACG
GCGTCAGAGCAGCCTATGCCATGAGGCATTGCGCGACTTGGTCCTCGAGACGCGTGAGTTTAGCAAGCTGATTGG
CGACATTACCCCCGACGGCCACGGCATCCGTGGCGTCATCCAGGAGCGTGTCCCGCTCCTGGAACTGGACCACGA
TGACGACTTTGTTCGCGCACTGACGCTGCAAGCCGCCGGCTTCGCCGACGAGAATGGACGGACAACAGACGCCGT
ACTGCTCTATCACCTTGCAGCCGAGTACGACACAGTTGTGGCCATTGTCAGCCGTTCTCTCAGCGAGGCCATTTC
CATGCAGCTTGGCGAGGATCCGTTGCGCCTCGTGCCCGCCAAGCCGCGCGTTGACGGCACGGTGGACAAGGAGCA
ACAGCCACAAGGCAGCAGTCTCAGCCTCGCCGCCATTGACGATCCCGTCGAGCTGGCGCGCACCATGATGACCAT
GTACGATCGCGACGTCAACTTTTACGGAAACATCCAAGACAACAACAAGACGGCGTGCCGAGTCCTGCTTCAAAT
GAGCAGCATTAAAAAGCTAGTCGAGGCTGGTTCCTGGGCTTTAGCTCTTGATGTAAGTTGTGCCCCCCCTCAATG
GCCTCAAACAATGCTAATCAGCCCCTTTTTTTGGCCCCTTGCAGAAGATCAAGTTGCTTGAAATCCTGCCCCTGG
CTGCTGAAGGCGACGCGAGCACAGTGCGCGCCTATGCCGCCCGCTTCTCAGGCCTCTCTCAGCCCGTCGCCATCA
ATGTGCCAAATCTACTCATGTGGACTGTCCTGTGTTGCGTCAGACAGCGCGAGCAGCTTACCAATGGCCGATATA
GCGGCAACGAGGGCACACGCCGCATGCTCCTTGATCAACTCAGGCAAATAACGCTCGATTTGACGGCATACACGA
GCCAGCTGCGATATCGCTTCCCGCCGCATTTGCACGAGGCGCTGGCCAGGGCTTCGGCAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail