Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3505
Gene name
LocationContig_268:14742..15270
Strand-
Gene length (bp)528
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6110
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3505 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2559
Ophiocordyceps kimflemingae Ophio5|2506
Ophiocordyceps subramaniannii Hirsu2|3625

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3505
MRHGRSPPDTAASRALQATALLPWQPHEQLYAEDAYLTNLLCVQATTTMHLIERYAALETQLQRLGMGKPRRRLR
KQLSLLRLQINEGAVQQRTILVRLSELYVQAHGHDIWGQVHGHETWGQVHGHETMWWGYSLDQTDQTCATVMSSP
NTRSTHPTVLNGASPEFVPVGPLPT*
Coding >OphauG2|3505
ATGCGCCACGGCCGCAGCCCGCCAGACACGGCAGCATCGCGGGCCCTGCAAGCCACGGCCCTGCTGCCATGGCAG
CCACACGAACAGCTCTATGCCGAGGACGCCTATTTGACAAACTTGTTGTGTGTGCAGGCCACAACGACCATGCAT
CTGATTGAGCGTTACGCTGCACTCGAAACACAGCTCCAGCGTCTTGGCATGGGAAAGCCGCGACGGAGACTGCGA
AAGCAGCTCAGTTTGCTGCGTCTGCAGATCAACGAGGGCGCTGTGCAACAACGAACAATTCTTGTCCGACTGAGC
GAGTTGTACGTCCAAGCCCATGGCCACGACATCTGGGGCCAAGTCCACGGCCATGAGACCTGGGGCCAGGTACAC
GGCCACGAGACAATGTGGTGGGGCTACAGCCTCGATCAAACAGATCAAACATGTGCCACCGTAATGTCGTCTCCA
AACACCAGATCGACCCACCCGACAGTCCTAAATGGCGCCTCCCCAGAGTTTGTGCCGGTAGGCCCGCTGCCGACT
TGA
Transcript >OphauG2|3505
ATGCGCCACGGCCGCAGCCCGCCAGACACGGCAGCATCGCGGGCCCTGCAAGCCACGGCCCTGCTGCCATGGCAG
CCACACGAACAGCTCTATGCCGAGGACGCCTATTTGACAAACTTGTTGTGTGTGCAGGCCACAACGACCATGCAT
CTGATTGAGCGTTACGCTGCACTCGAAACACAGCTCCAGCGTCTTGGCATGGGAAAGCCGCGACGGAGACTGCGA
AAGCAGCTCAGTTTGCTGCGTCTGCAGATCAACGAGGGCGCTGTGCAACAACGAACAATTCTTGTCCGACTGAGC
GAGTTGTACGTCCAAGCCCATGGCCACGACATCTGGGGCCAAGTCCACGGCCATGAGACCTGGGGCCAGGTACAC
GGCCACGAGACAATGTGGTGGGGCTACAGCCTCGATCAAACAGATCAAACATGTGCCACCGTAATGTCGTCTCCA
AACACCAGATCGACCCACCCGACAGTCCTAAATGGCGCCTCCCCAGAGTTTGTGCCGGTAGGCCCGCTGCCGACT
TGA
Gene >OphauG2|3505
ATGCGCCACGGCCGCAGCCCGCCAGACACGGCAGCATCGCGGGCCCTGCAAGCCACGGCCCTGCTGCCATGGCAG
CCACACGAACAGCTCTATGCCGAGGACGCCTATTTGACAAACTTGTTGTGTGTGCAGGCCACAACGACCATGCAT
CTGATTGAGCGTTACGCTGCACTCGAAACACAGCTCCAGCGTCTTGGCATGGGAAAGCCGCGACGGAGACTGCGA
AAGCAGCTCAGTTTGCTGCGTCTGCAGATCAACGAGGGCGCTGTGCAACAACGAACAATTCTTGTCCGACTGAGC
GAGTTGTACGTCCAAGCCCATGGCCACGACATCTGGGGCCAAGTCCACGGCCATGAGACCTGGGGCCAGGTACAC
GGCCACGAGACAATGTGGTGGGGCTACAGCCTCGATCAAACAGATCAAACATGTGCCACCGTAATGTCGTCTCCA
AACACCAGATCGACCCACCCGACAGTCCTAAATGGCGCCTCCCCAGAGTTTGTGCCGGTAGGCCCGCTGCCGACT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail