Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3501
Gene name
LocationContig_268:5083..6699
Strand+
Gene length (bp)1616
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06911 Senescence Senescence domain 2.3E-62 258 443

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8R1X6|SPG20_MOUSE Spartin OS=Mus musculus GN=Spg20 PE=1 SV=1 259 444 4.0E-09
sp|A0JNJ3|SPG20_BOVIN Spartin OS=Bos taurus GN=SPG20 PE=2 SV=1 237 444 6.0E-09
sp|Q8N0X7|SPG20_HUMAN Spartin OS=Homo sapiens GN=SPG20 PE=1 SV=1 237 443 1.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5789
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3501 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2563
Ophiocordyceps camponoti-floridani Ophcf2|06367
Ophiocordyceps kimflemingae Ophio5|7517
Ophiocordyceps subramaniannii Hirsu2|9762

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3501
MDAGHNDPKLLYAVEGIKAYHLANGAEESLTPSGPQTLSLLMVPTASGFADGSGVGTGEQDFYLHLHLPPELDLA
LPATTQIYHQPPTSYLIPRWDLGPDSGAFTRVEFPAVGSRPGVQEDVDTFETILAQCTSFLERAPVPKRPQHQTG
SRAADAKAREAAGDELPPYNPGDYDPGEGYVQGSHSAATKGGRIVLVDEEDGSVVGELGEGFNVVEGSGVNPGSK
DPVEISLPADGSHNIAVQPVSMQDEMHPAYRKSTIVNTASRASRLLVTTSDYVSKTLQSQADSFTRNTKPVAKPM
TFTPTTHAHIRRINTFSNKAADISSATVGSISRVAQNLGAHVSRNKDGRGRGYDKDGKVIESYKPGVLNKSLMAF
NTVVDGMEQAGRNLLTSTSSSVTTVVHHRWGAEAGDVSRSLGGGVKNVGLVYIDVTGVSRRAILKSVARGMVVGK
VKGGGQVIVGGADNGQQAQGTGQGVGQGVGQGVADGSDKKMKS*
Coding >OphauG2|3501
ATGGACGCGGGCCACAATGACCCCAAGCTGCTCTACGCCGTCGAGGGCATCAAGGCCTACCATCTGGCCAACGGC
GCCGAGGAGTCGCTGACGCCCTCGGGCCCTCAAACTCTGTCGCTTCTCATGGTTCCCACAGCGTCTGGCTTCGCC
GATGGCTCGGGCGTCGGCACCGGCGAGCAGGACTTTTACCTGCACCTGCATCTCCCGCCTGAACTTGACCTGGCC
CTCCCTGCGACGACGCAGATATACCACCAGCCACCGACAAGCTACCTGATTCCACGCTGGGACCTCGGCCCCGAC
AGCGGCGCCTTTACGCGTGTCGAGTTCCCCGCCGTGGGCAGCCGGCCTGGTGTACAGGAAGACGTGGACACGTTT
GAGACTATTCTGGCCCAGTGCACCTCGTTTCTTGAGCGGGCGCCAGTTCCCAAGAGGCCACAGCACCAGACGGGC
TCACGCGCAGCAGACGCAAAGGCCCGTGAAGCGGCAGGTGACGAGCTGCCGCCCTACAATCCGGGCGACTATGAC
CCCGGCGAGGGCTATGTGCAGGGGAGCCACAGTGCGGCAACAAAGGGCGGCCGGATTGTGCTTGTTGATGAGGAA
GATGGTAGTGTGGTGGGAGAGCTGGGCGAAGGCTTCAATGTGGTGGAAGGAAGCGGCGTCAACCCTGGTTCCAAG
GACCCAGTGGAAATTTCACTGCCGGCTGATGGGTCGCACAACATTGCCGTGCAGCCGGTCTCGATGCAAGATGAA
ATGCACCCGGCGTATCGCAAATCGACCATTGTGAATACAGCTTCTCGGGCATCGCGGCTTCTGGTAACAACGTCG
GACTACGTGTCCAAGACGTTGCAGTCGCAAGCAGACAGCTTTACGCGCAACACCAAGCCGGTAGCCAAGCCCATG
ACGTTTACGCCCACGACACACGCGCACATACGGCGCATCAATACCTTTTCCAACAAGGCGGCTGACATATCGTCG
GCTACCGTGGGCTCAATCAGCCGCGTGGCGCAGAACCTGGGGGCGCACGTGTCGCGAAACAAGGATGGGCGGGGG
CGGGGTTACGACAAGGATGGCAAAGTGATTGAGAGCTATAAGCCGGGCGTGCTCAACAAGAGCCTCATGGCATTT
AACACGGTTGTGGACGGCATGGAGCAGGCGGGGCGCAATTTGCTGACGAGCACTTCGTCGAGTGTCACGACGGTA
GTCCACCATCGCTGGGGTGCCGAGGCTGGAGATGTGTCGCGCAGTCTGGGAGGAGGCGTCAAGAACGTTGGCCTT
GTCTATATTGACGTGACGGGAGTCTCGCGCCGTGCCATTCTCAAGAGCGTGGCACGCGGCATGGTGGTGGGCAAG
GTCAAGGGAGGCGGCCAAGTCATTGTTGGCGGCGCCGACAATGGGCAGCAGGCGCAGGGCACGGGACAGGGCGTG
GGACAGGGCGTGGGACAGGGCGTGGCAGACGGCTCGGACAAGAAGATGAAGTCTTGA
Transcript >OphauG2|3501
ATGGACGCGGGCCACAATGACCCCAAGCTGCTCTACGCCGTCGAGGGCATCAAGGCCTACCATCTGGCCAACGGC
GCCGAGGAGTCGCTGACGCCCTCGGGCCCTCAAACTCTGTCGCTTCTCATGGTTCCCACAGCGTCTGGCTTCGCC
GATGGCTCGGGCGTCGGCACCGGCGAGCAGGACTTTTACCTGCACCTGCATCTCCCGCCTGAACTTGACCTGGCC
CTCCCTGCGACGACGCAGATATACCACCAGCCACCGACAAGCTACCTGATTCCACGCTGGGACCTCGGCCCCGAC
AGCGGCGCCTTTACGCGTGTCGAGTTCCCCGCCGTGGGCAGCCGGCCTGGTGTACAGGAAGACGTGGACACGTTT
GAGACTATTCTGGCCCAGTGCACCTCGTTTCTTGAGCGGGCGCCAGTTCCCAAGAGGCCACAGCACCAGACGGGC
TCACGCGCAGCAGACGCAAAGGCCCGTGAAGCGGCAGGTGACGAGCTGCCGCCCTACAATCCGGGCGACTATGAC
CCCGGCGAGGGCTATGTGCAGGGGAGCCACAGTGCGGCAACAAAGGGCGGCCGGATTGTGCTTGTTGATGAGGAA
GATGGTAGTGTGGTGGGAGAGCTGGGCGAAGGCTTCAATGTGGTGGAAGGAAGCGGCGTCAACCCTGGTTCCAAG
GACCCAGTGGAAATTTCACTGCCGGCTGATGGGTCGCACAACATTGCCGTGCAGCCGGTCTCGATGCAAGATGAA
ATGCACCCGGCGTATCGCAAATCGACCATTGTGAATACAGCTTCTCGGGCATCGCGGCTTCTGGTAACAACGTCG
GACTACGTGTCCAAGACGTTGCAGTCGCAAGCAGACAGCTTTACGCGCAACACCAAGCCGGTAGCCAAGCCCATG
ACGTTTACGCCCACGACACACGCGCACATACGGCGCATCAATACCTTTTCCAACAAGGCGGCTGACATATCGTCG
GCTACCGTGGGCTCAATCAGCCGCGTGGCGCAGAACCTGGGGGCGCACGTGTCGCGAAACAAGGATGGGCGGGGG
CGGGGTTACGACAAGGATGGCAAAGTGATTGAGAGCTATAAGCCGGGCGTGCTCAACAAGAGCCTCATGGCATTT
AACACGGTTGTGGACGGCATGGAGCAGGCGGGGCGCAATTTGCTGACGAGCACTTCGTCGAGTGTCACGACGGTA
GTCCACCATCGCTGGGGTGCCGAGGCTGGAGATGTGTCGCGCAGTCTGGGAGGAGGCGTCAAGAACGTTGGCCTT
GTCTATATTGACGTGACGGGAGTCTCGCGCCGTGCCATTCTCAAGAGCGTGGCACGCGGCATGGTGGTGGGCAAG
GTCAAGGGAGGCGGCCAAGTCATTGTTGGCGGCGCCGACAATGGGCAGCAGGCGCAGGGCACGGGACAGGGCGTG
GGACAGGGCGTGGGACAGGGCGTGGCAGACGGCTCGGACAAGAAGATGAAGTCTTGA
Gene >OphauG2|3501
ATGGACGCGGGCCACAATGTATGTACAGTTATTTGTTTTGTTTGTTGTGCTTGTGTCGCTACCGTTGCGCTAACA
GCCGTCAACCCTAGGACCCCAAGCTGCTCTACGCCGTCGAGGGCATCAAGGCCTACCATCTGGCCAACGGCGCCG
AGGAGTCGCTGACGCCCTCGGGCCCTCAAACTCTGTCGCTTCTCATGGTTCCCACAGCGTCTGGCTTCGCCGATG
GCTCGGGCGTCGGCACCGGCGAGCAGGACTTTTACCTGCACCTGCATCTCCCGCCTGAACTTGACCTGGCCCTCC
CTGCGACGACGCAGATATACCACCAGCCACCGACAAGCTACCTGATTCCACGCTGGGACCTCGGCCCCGACAGCG
GCGCCTTTACGCGTGTCGAGTTCCCCGCCGTGGGCAGCCGGCCTGGTGTACAGGAAGACGTGGACACGTTTGAGA
CTATTCTGGCCCAGTGCACCTCGTTTCTTGAGCGGGCGCCAGTTCCCAAGAGGCCACAGCACCAGACGGGCTCAC
GCGCAGCAGACGCAAAGGCCCGTGAAGCGGCAGGTGACGAGCTGCCGCCCTACAATCCGGGCGACTATGACCCCG
GCGAGGGCTATGTGCAGGGGAGCCACAGTGCGGCAACAAAGGGCGGCCGGATTGTGCTTGTTGATGAGGAAGATG
GTAGTGTGGTGGGAGAGCTGGGCGAAGGCTTCAATGTGGTGGAAGGAAGCGGCGTCAACCCTGGTTCCAAGGGTG
AGACGGCTGCAAGCCCTGCTAGATTTGTCGTCCATGTGCTGACCAAGAGGATTGCTCCAGACCCAGTGGAAATTT
CACTGCCGGCTGATGGGTCGCACAACATTGCCGTGCAGCCGGTCTCGATGCAAGATGAAATGCACCCGGCGTATC
GCAAATCGACCATTGTGAATACAGCTTCTCGGGCATCGCGGCTTCTGGTAACAACGTCGGACTACGTGTCCAAGA
CGTTGCAGTCGCAAGCAGACAGCTTTACGCGCAACACCAAGCCGGTAGCCAAGCCCATGACGTTTACGCCCACGA
CACACGCGCACATACGGCGCATCAATACCTTTTCCAACAAGGCGGCTGACATATCGTCGGCTACCGTGGGCTCAA
TCAGCCGCGTGGCGCAGAACCTGGGGGCGCACGTGTCGCGAAACAAGGATGGGCGGGGGCGGGGTTACGACAAGG
ATGGCAAAGTGATTGAGAGCTATAAGCCGGGCGTGCTCAACAAGAGCCTCATGGCATTTAACACGGTTGTGGACG
GCATGGAGCAGGCGGGGCGCAATTTGCTGACGAGCACTTCGTCGAGTGTCACGACGGTAGTCCACCATCGCTGGG
GTGCCGAGGCTGGAGATGTGTCGCGCAGTCTGGGAGGAGGCGTCAAGAACGTTGGCCTTGTCTATATTGACGTGA
CGGGAGTCTCGCGCCGTGCCATTCTCAAGAGCGTGGCACGCGGCATGGTGGTGGGCAAGGTCAAGGGAGGCGGCC
AAGTCATTGTTGGCGGCGCCGACAATGGGCAGCAGGCGCAGGGCACGGGACAGGGCGTGGGACAGGGCGTGGGAC
AGGGCGTGGCAGACGGCTCGGACAAGAAGATGAAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail