Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3500
Gene name
LocationContig_268:1718..4032
Strand-
Gene length (bp)2314
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.4E-29 2 249
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 4.6E-20 307 744

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens GN=TUBGCP4 PE=1 SV=1 1 538 6.0E-13

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4644
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3500 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2564
Ophiocordyceps camponoti-floridani Ophcf2|06368
Ophiocordyceps camponoti-rufipedis Ophun1|895
Ophiocordyceps kimflemingae Ophio5|7518
Ophiocordyceps subramaniannii Hirsu2|9764

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3500
MLHEILLSLSGHASPLLQSADTDSHTDAHPLAAATPSERQLLATVARLANVHTQVMALTAQISTSHPSPICKAVA
TGIKSLHLAAFQHKILQVEETILKGDANLVGAYNIVPLTAIVGEFKPWTRKMNWLLEIVGFVTATQKGSTCHGPR
LMDRLRDETRSGYQDIAEMALSLLRVAETAWLKQVSAWVLYGRLPGADAAADFFVQKTADEDFVCIAERVPSFVT
SSTAWSMLFIGKSLNHIGVLRTSSFQLGHVESIYDRARQISSLDLPLSAANFTRTMTLIRRSLSETTLQKALPLI
RIVQVIDLLREFFLLGRGEFAMVLTNEAEEQMRGQWPRTTSLAHEESKVDKVTVNDSQVAAALKKTWVALASMQG
QDADEDEQLEQARTMLTLSLEKSNSLPPLTAGRGLSTEAVGLLESSPFSNLLFSVPVALGLKISSPLDMIISPSD
LRLYSCMNSYLVSLRRAHIRLTDLWKMTSLRRHYVAPIGAGEDAVAQRRRWSTRSSMMRDTWTTASAAIFLLGET
EAYLQTEVVRGMWKTFYKWLTGCNAQTEMRDGGRRRTARSDDVAGPDDDGPGESDRQADLVNKPQHDVQALSVAH
GLYLRTLVFRLLLTQASFTEPLYKLLQDIDGMVSQVQRLHSIFTLMDLETDAGVLDASVNLEQEQDEVFGLLRRV
QTRVRGGIGKVTGALRRLGSEADFLAEWEVRGMAADEDEYEYDGLWEGGQRYVPGRIGGIDRLLMKLDFGTWLED
EE*
Coding >OphauG2|3500
ATGCTCCATGAGATTCTCCTCTCCCTCTCGGGACATGCGTCCCCTCTCCTCCAATCCGCCGACACCGATTCCCAT
ACCGACGCGCATCCGCTCGCCGCAGCCACTCCTTCAGAGCGCCAGCTATTAGCTACTGTCGCTCGCCTCGCCAAT
GTACACACTCAGGTCATGGCCCTCACGGCCCAGATATCCACCTCGCATCCCTCTCCCATTTGCAAAGCTGTCGCA
ACAGGCATCAAGTCGCTACACCTAGCTGCCTTTCAACACAAGATCTTGCAAGTCGAGGAGACGATTCTCAAAGGC
GACGCGAACCTTGTGGGCGCCTACAATATCGTCCCCCTTACCGCCATTGTAGGCGAGTTTAAGCCGTGGACAAGG
AAAATGAACTGGCTGTTGGAAATTGTTGGCTTCGTCACGGCTACACAAAAAGGATCCACGTGTCATGGTCCGCGT
CTTATGGATCGGCTGAGGGATGAAACGCGCAGCGGCTACCAAGACATTGCGGAAATGGCTCTGAGCTTGCTGAGA
GTTGCCGAAACGGCATGGCTTAAGCAAGTCTCTGCTTGGGTGCTCTATGGCAGGCTACCAGGTGCCGACGCTGCA
GCCGATTTTTTTGTGCAAAAGACAGCTGATGAGGACTTTGTATGCATCGCGGAGCGCGTGCCATCGTTTGTGACC
TCTTCAACCGCGTGGTCAATGCTCTTTATTGGCAAGTCCCTCAATCATATTGGCGTCCTGCGCACATCAAGCTTT
CAACTTGGCCATGTCGAAAGCATTTATGACAGGGCCAGACAAATATCTAGTCTCGACTTGCCGCTAAGCGCTGCA
AATTTCACGAGAACCATGACATTGATCCGTCGCTCACTTTCAGAGACTACGCTACAAAAAGCTTTACCCTTGATA
AGAATTGTTCAAGTAATTGACTTGCTGCGAGAGTTTTTCTTGCTTGGCCGTGGCGAGTTTGCCATGGTCTTGACA
AATGAGGCCGAGGAGCAGATGCGCGGCCAGTGGCCAAGGACTACAAGTCTAGCACATGAAGAGAGCAAAGTTGAC
AAGGTGACAGTCAATGACAGCCAGGTGGCTGCTGCTTTGAAAAAGACTTGGGTGGCATTGGCGTCGATGCAAGGA
CAAGACGCTGATGAGGATGAGCAACTGGAACAAGCTCGCACTATGCTGACGTTGAGCCTGGAAAAGTCGAATTCT
TTGCCGCCATTGACAGCAGGACGTGGACTGAGTACTGAGGCCGTCGGGTTGTTAGAGTCGTCGCCCTTTTCCAAT
TTACTCTTTTCGGTCCCTGTGGCACTTGGGCTCAAGATATCGTCACCGCTGGACATGATTATATCGCCGTCGGAC
CTGAGACTATATTCCTGCATGAATAGTTATCTTGTTTCTCTGCGGCGGGCTCATATTCGACTGACGGACCTGTGG
AAGATGACGTCGCTGAGGCGCCATTATGTAGCCCCAATAGGCGCCGGAGAGGATGCAGTAGCGCAGAGAAGAAGA
TGGTCGACGAGATCGTCCATGATGCGTGACACATGGACAACGGCAAGTGCCGCCATTTTTTTGCTGGGCGAAACA
GAGGCATATCTGCAGACAGAAGTTGTGCGAGGCATGTGGAAGACGTTTTACAAGTGGCTCACGGGTTGCAATGCG
CAGACGGAGATGAGAGATGGCGGTCGACGGCGGACAGCAAGGTCAGATGATGTAGCCGGGCCTGATGATGACGGG
CCTGGTGAGAGCGACAGGCAGGCCGACTTGGTCAACAAGCCGCAGCATGACGTGCAAGCCCTCTCAGTGGCGCAT
GGACTGTACCTGAGGACGCTTGTTTTTCGCCTTTTACTCACGCAGGCTAGCTTTACGGAGCCGCTTTACAAGCTG
CTACAGGATATTGACGGCATGGTATCGCAGGTGCAACGGCTGCACTCCATCTTTACATTGATGGACCTGGAGACG
GACGCAGGCGTCTTGGACGCGTCGGTGAATTTGGAGCAGGAGCAAGACGAGGTGTTTGGGCTGCTGCGCAGAGTG
CAGACGCGGGTGCGTGGCGGGATTGGCAAGGTGACTGGTGCGTTGCGCAGGCTGGGAAGCGAGGCAGACTTCTTG
GCAGAGTGGGAGGTGCGAGGCATGGCGGCGGACGAGGACGAGTATGAATATGACGGGCTGTGGGAGGGAGGACAG
CGCTATGTGCCGGGCCGGATAGGAGGCATCGACAGGCTGCTGATGAAGCTCGACTTTGGAACATGGTTGGAGGAC
GAGGAGTGA
Transcript >OphauG2|3500
ATGCTCCATGAGATTCTCCTCTCCCTCTCGGGACATGCGTCCCCTCTCCTCCAATCCGCCGACACCGATTCCCAT
ACCGACGCGCATCCGCTCGCCGCAGCCACTCCTTCAGAGCGCCAGCTATTAGCTACTGTCGCTCGCCTCGCCAAT
GTACACACTCAGGTCATGGCCCTCACGGCCCAGATATCCACCTCGCATCCCTCTCCCATTTGCAAAGCTGTCGCA
ACAGGCATCAAGTCGCTACACCTAGCTGCCTTTCAACACAAGATCTTGCAAGTCGAGGAGACGATTCTCAAAGGC
GACGCGAACCTTGTGGGCGCCTACAATATCGTCCCCCTTACCGCCATTGTAGGCGAGTTTAAGCCGTGGACAAGG
AAAATGAACTGGCTGTTGGAAATTGTTGGCTTCGTCACGGCTACACAAAAAGGATCCACGTGTCATGGTCCGCGT
CTTATGGATCGGCTGAGGGATGAAACGCGCAGCGGCTACCAAGACATTGCGGAAATGGCTCTGAGCTTGCTGAGA
GTTGCCGAAACGGCATGGCTTAAGCAAGTCTCTGCTTGGGTGCTCTATGGCAGGCTACCAGGTGCCGACGCTGCA
GCCGATTTTTTTGTGCAAAAGACAGCTGATGAGGACTTTGTATGCATCGCGGAGCGCGTGCCATCGTTTGTGACC
TCTTCAACCGCGTGGTCAATGCTCTTTATTGGCAAGTCCCTCAATCATATTGGCGTCCTGCGCACATCAAGCTTT
CAACTTGGCCATGTCGAAAGCATTTATGACAGGGCCAGACAAATATCTAGTCTCGACTTGCCGCTAAGCGCTGCA
AATTTCACGAGAACCATGACATTGATCCGTCGCTCACTTTCAGAGACTACGCTACAAAAAGCTTTACCCTTGATA
AGAATTGTTCAAGTAATTGACTTGCTGCGAGAGTTTTTCTTGCTTGGCCGTGGCGAGTTTGCCATGGTCTTGACA
AATGAGGCCGAGGAGCAGATGCGCGGCCAGTGGCCAAGGACTACAAGTCTAGCACATGAAGAGAGCAAAGTTGAC
AAGGTGACAGTCAATGACAGCCAGGTGGCTGCTGCTTTGAAAAAGACTTGGGTGGCATTGGCGTCGATGCAAGGA
CAAGACGCTGATGAGGATGAGCAACTGGAACAAGCTCGCACTATGCTGACGTTGAGCCTGGAAAAGTCGAATTCT
TTGCCGCCATTGACAGCAGGACGTGGACTGAGTACTGAGGCCGTCGGGTTGTTAGAGTCGTCGCCCTTTTCCAAT
TTACTCTTTTCGGTCCCTGTGGCACTTGGGCTCAAGATATCGTCACCGCTGGACATGATTATATCGCCGTCGGAC
CTGAGACTATATTCCTGCATGAATAGTTATCTTGTTTCTCTGCGGCGGGCTCATATTCGACTGACGGACCTGTGG
AAGATGACGTCGCTGAGGCGCCATTATGTAGCCCCAATAGGCGCCGGAGAGGATGCAGTAGCGCAGAGAAGAAGA
TGGTCGACGAGATCGTCCATGATGCGTGACACATGGACAACGGCAAGTGCCGCCATTTTTTTGCTGGGCGAAACA
GAGGCATATCTGCAGACAGAAGTTGTGCGAGGCATGTGGAAGACGTTTTACAAGTGGCTCACGGGTTGCAATGCG
CAGACGGAGATGAGAGATGGCGGTCGACGGCGGACAGCAAGGTCAGATGATGTAGCCGGGCCTGATGATGACGGG
CCTGGTGAGAGCGACAGGCAGGCCGACTTGGTCAACAAGCCGCAGCATGACGTGCAAGCCCTCTCAGTGGCGCAT
GGACTGTACCTGAGGACGCTTGTTTTTCGCCTTTTACTCACGCAGGCTAGCTTTACGGAGCCGCTTTACAAGCTG
CTACAGGATATTGACGGCATGGTATCGCAGGTGCAACGGCTGCACTCCATCTTTACATTGATGGACCTGGAGACG
GACGCAGGCGTCTTGGACGCGTCGGTGAATTTGGAGCAGGAGCAAGACGAGGTGTTTGGGCTGCTGCGCAGAGTG
CAGACGCGGGTGCGTGGCGGGATTGGCAAGGTGACTGGTGCGTTGCGCAGGCTGGGAAGCGAGGCAGACTTCTTG
GCAGAGTGGGAGGTGCGAGGCATGGCGGCGGACGAGGACGAGTATGAATATGACGGGCTGTGGGAGGGAGGACAG
CGCTATGTGCCGGGCCGGATAGGAGGCATCGACAGGCTGCTGATGAAGCTCGACTTTGGAACATGGTTGGAGGAC
GAGGAGTGA
Gene >OphauG2|3500
ATGCTCCATGAGATTCTCCTCTCCCTCTCGGGACATGCGTCCCCTCTCCTCCAATCCGCCGACACCGATTCCCAT
ACCGACGCGCATCCGCTCGCCGCAGCCACTCCTTCAGAGCGCCAGCTATTAGCTACTGTCGCTCGCCTCGCCAAT
GTACACACTCAGGTCATGGCCCTCACGGCCCAGATATCCACCTCGCATCCCTCTCCCATTTGCAAAGCTGTCGCA
ACAGGCATCAAGTCGCTACACCTAGCTGCCTTTCAACACAAGATCTTGCAAGTCGAGGAGACGATTCTCAAAGGC
GACGCGAACCTTGTGGGCGCCTACAATATCGTCCCCCTTACCGCCATTGTAGGCGAGTTTAAGCCGTGGACAAGG
AAAATGAACTGGCTGTTGGAAATTGTTGGCTTCGTCACGGCTACACAAAAAGGATCCACGTGTCATGGTCCGCGT
CTTATGGATCGGCTGAGGGATGAAACGCGCAGCGGCTACCAAGACATTGCGGAAATGGCTCTGAGCTTGCTGAGA
GTTGCCGAAACGGCATGGCTTAAGCAAGTCTCTGCTTGGGTGCTCTATGGCAGGCTACCAGGTGCCGACGCTGCA
GCCGATTTTTTTGTGCAAAAGACAGCTGATGAGGTTGGACGCATCACTGCACCTCGACTAGTTGCACTCTGCTAA
CTCGCAACGATAGGACTTTGTATGCATCGCGGAGCGCGTGCCATCGTTTGTGACCTCTTCAACCGCGTGGTCAAT
GCTCTTTATTGGCAAGTCCCTCAATCATATTGGCGTCCTGCGCACATCAAGCTTTCAACTTGGCCATGTCGAAAG
CATTTATGACAGGGCCAGACAAATATCTAGTCTCGACTTGCCGCTAAGCGCTGCAAATTTCACGAGAACCATGAC
ATTGATCCGTCGCTCACTTTCAGAGACTACGCTACAAAAAGCTTTACCCTTGATAAGAATTGTTCAAGTAATTGA
CTTGCTGCGAGAGTTTTTCTTGCTTGGCCGTGGCGAGTTTGCCATGGTCTTGACAAATGAGGCCGAGGAGCAGAT
GCGCGGCCAGTGGCCAAGGACTACAAGTCTAGCACATGAAGAGAGCAAAGTTGACAAGGTGACAGTCAATGACAG
CCAGGTGGCTGCTGCTTTGAAAAAGACTTGGGTGGCATTGGCGTCGATGCAAGGACAAGACGCTGATGAGGATGA
GCAACTGGAACAAGCTCGCACTATGCTGACGTTGAGCCTGGAAAAGTCGAATTCTTTGCCGCCATTGACAGCAGG
ACGTGGACTGAGTACTGAGGCCGTCGGGTTGTTAGAGTCGTCGCCCTTTTCCAATTTACTCTTTTCGGTCCCTGT
GGCACTTGGGCTCAAGATATCGTCACCGCTGGACATGATTATATCGCCGTCGGACCTGAGACTATATTCCTGCAT
GAATAGTTATCTTGTTTCTCTGCGGCGGGCTCATATTCGACTGACGGACCTGTGGAAGATGACGTCGCTGAGGCG
CCATTATGTAGCCCCAATAGGCGCCGGAGAGGATGCAGTAGCGCAGAGAAGAAGATGGTCGACGAGATCGTCCAT
GATGCGTGACACATGGACAACGGCAAGTGCCGCCATTTTTTTGCTGGGCGAAACAGAGGCATATCTGCAGACAGA
AGTTGTGCGAGGCATGTGGAAGACGTTTTACAAGTGGCTCACGGGTTGCAATGCGCAGACGGAGATGAGAGATGG
CGGTCGACGGCGGACAGCAAGGTCAGATGATGTAGCCGGGCCTGATGATGACGGGCCTGGTGAGAGCGACAGGCA
GGCCGACTTGGTCAACAAGCCGCAGCATGACGTGCAAGCCCTCTCAGTGGCGCATGGACTGTACCTGAGGACGCT
TGTTTTTCGCCTTTTACTCACGCAGGCTAGCTTTACGGAGCCGCTTTACAAGCTGCTACAGGATATTGACGGCAT
GGTATCGCAGGTGCAACGGCTGCACTCCATCTTTACATTGATGGACCTGGAGACGGACGCAGGCGTCTTGGACGC
GTCGGTGAATTTGGAGCAGGAGCAAGACGAGGTGTTTGGGCTGCTGCGCAGAGTGCAGACGCGGGTGCGTGGCGG
GATTGGCAAGGTGACTGGTGCGTTGCGCAGGCTGGGAAGCGAGGCAGACTTCTTGGCAGAGTGGGAGGTGCGAGG
CATGGCGGCGGACGAGGACGAGTATGAATATGACGGGCTGTGGGAGGGAGGACAGCGCTATGTGCCGGGCCGGAT
AGGAGGCATCGACAGGCTGCTGATGAAGCTCGACTTTGGAACATGGTTGGAGGACGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail