Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|350
Gene name
LocationContig_1079:2524..3925
Strand+
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 2.7E-33 156 441

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QG68|RGXB_ASPNC Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxB PE=2 SV=2 43 445 2.0E-95
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 61 446 2.0E-54
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 61 446 3.0E-54
sp|Q2UP32|RGXA_ASPOR Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgxA PE=3 SV=1 53 446 3.0E-53
sp|B8NJB0|RGXA_ASPFN Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rgxA PE=3 SV=2 53 446 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QG68|RGXB_ASPNC Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxB PE=2 SV=2 43 445 2.0E-95
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 61 446 2.0E-54
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 61 446 3.0E-54
sp|Q2UP32|RGXA_ASPOR Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgxA PE=3 SV=1 53 446 3.0E-53
sp|B8NJB0|RGXA_ASPFN Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rgxA PE=3 SV=2 53 446 3.0E-53
sp|A1DLC1|PGLRX_NEOFI Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaX PE=3 SV=2 59 438 6.0E-50
sp|Q4WCZ8|PGLRX_ASPFU Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaX PE=3 SV=2 25 438 1.0E-48
sp|B0YDE8|PGLRX_ASPFC Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaX PE=3 SV=2 25 438 1.0E-48
sp|Q0CGP0|PGLRX_ASPTN Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaX PE=3 SV=1 16 438 1.0E-47
sp|Q5ASG9|PGLX1_EMENI Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-1 PE=1 SV=1 58 352 5.0E-46
sp|B8NG16|PGLRX_ASPFN Probable exopolygalacturonase X OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaX PE=3 SV=1 53 352 1.0E-45
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 36 438 2.0E-45
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 36 438 3.0E-44
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 36 438 3.0E-44
sp|Q5ARN5|PGLX2_EMENI Exopolygalacturonase X-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-2 PE=2 SV=1 13 434 7.0E-41
sp|Q00359|PGLRX_COCCA Exopolygalacturonase OS=Cochliobolus carbonum GN=PGX1 PE=3 SV=1 1 451 2.0E-40
sp|Q27UB2|PGXA_ASPNG Exopolygalacturonase A OS=Aspergillus niger GN=pgxA PE=3 SV=1 55 437 4.0E-34
sp|A2QW66|PGXA_ASPNC Probable exopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxA PE=3 SV=1 55 437 4.0E-34
sp|A2RAY7|RGXC_ASPNC Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxC PE=2 SV=1 58 405 2.0E-33
sp|B8NX60|PGXB_ASPFN Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxB PE=3 SV=1 58 450 1.0E-32
sp|Q2TW03|PGXB_ASPOR Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxB PE=3 SV=2 58 450 1.0E-32
sp|Q873X6|PGXB_EMENI Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgxB PE=2 SV=1 58 449 1.0E-30
sp|A2QHG0|PGXB_ASPNC Probable exopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxB PE=3 SV=1 58 445 2.0E-29
sp|Q27UB1|PGXB_ASPNG Exopolygalacturonase B OS=Aspergillus niger GN=pgxB PE=3 SV=1 58 445 2.0E-29
sp|A1D415|RGXC_NEOFI Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgxC PE=3 SV=1 34 419 2.0E-27
sp|A1DAX2|PGXB_NEOFI Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxB PE=3 SV=1 58 445 4.0E-27
sp|Q0C7H7|PGXB_ASPTN Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxB PE=3 SV=1 58 445 1.0E-25
sp|I1BYN6|RPG16_RHIO9 Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg16 PE=1 SV=1 61 439 1.0E-24
sp|B0YAA4|PGXB_ASPFC Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxB PE=3 SV=2 80 445 1.0E-24
sp|Q4WBK6|PGXB_ASPFU Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxB PE=3 SV=2 80 445 2.0E-24
sp|Q4WBT4|XGHA_ASPFU Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xghA PE=3 SV=2 52 445 2.0E-24
sp|B0Y9F8|XGHA_ASPFC Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xghA PE=3 SV=2 52 445 8.0E-24
sp|Q5B7U1|XGHA_EMENI Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xghA PE=3 SV=1 56 427 2.0E-23
sp|A1DBT5|XGHA_NEOFI Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xghA PE=3 SV=1 44 445 4.0E-23
sp|Q9UUZ2|XGHA_ASPTU Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis GN=xghA PE=1 SV=1 39 395 4.0E-23
sp|A2QK83|XGHA_ASPNC Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xghA PE=3 SV=1 44 395 1.0E-22
sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 134 437 3.0E-22
sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 134 437 3.0E-22
sp|Q2UBD8|XGHA_ASPOR Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xghA PE=3 SV=1 44 446 3.0E-21
sp|B8NPS8|XGHA_ASPFN Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xghA PE=3 SV=1 44 446 8.0E-21
sp|I1BYM7|RPG15_RHIO9 Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg15 PE=1 SV=1 51 423 2.0E-20
sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 157 437 4.0E-20
sp|P49063|PGLR2_ARATH Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=2 SV=2 161 437 2.0E-19
sp|P24548|PGLR_OENOR Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1 157 437 4.0E-18
sp|P49062|PGLR1_ARATH Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana GN=PGA3 PE=2 SV=1 157 438 3.0E-17
sp|Q949Z1|PGLR4_ARATH Polygalacturonase At1g48100 OS=Arabidopsis thaliana GN=At1g48100 PE=2 SV=1 71 439 5.0E-17
sp|P35337|PGLR_BRANA Polygalacturonase OS=Brassica napus PE=2 SV=1 134 437 4.0E-16
sp|Q9LW07|PGLR3_ARATH Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1 156 444 5.0E-15
sp|A1D7I1|PGXC_NEOFI Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxC PE=3 SV=1 25 392 8.0E-15
sp|Q4WX94|PGXC_ASPFU Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxC PE=3 SV=1 71 392 1.0E-14
sp|B0XYC4|PGXC_ASPFC Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxC PE=3 SV=1 71 392 1.0E-14
sp|Q94AJ5|PGLR5_ARATH Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=1 SV=1 36 441 4.0E-14
sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 157 437 9.0E-14
sp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2 71 438 2.0E-13
sp|Q2UQ40|PGXC_ASPOR Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxC PE=3 SV=1 54 392 6.0E-13
sp|B8MZZ6|PGXC_ASPFN Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxC PE=3 SV=1 54 392 6.0E-13
sp|Q0CXI3|PGXC_ASPTN Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxC PE=3 SV=1 61 392 1.0E-12
sp|O22818|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1 159 441 2.0E-12
sp|P43212|PGLR2_CRYJA Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1 157 439 6.0E-12
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1 67 440 1.0E-11
sp|Q05967|PGLR_TOBAC Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1 152 437 2.0E-11
sp|I1BYN5|RPG14_RHIO9 Exopolygalacturonase rpg14 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg14 PE=1 SV=1 55 444 2.0E-11
sp|P48978|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1 67 391 3.0E-11
sp|Q7M1E7|PGLR2_CHAOB Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=1 117 349 3.0E-10
sp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2 71 391 4.0E-10
sp|P48979|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1 159 421 5.0E-10
sp|A2QEW2|PGXC_ASPNC Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxC PE=3 SV=2 49 392 5.0E-10
sp|Q27UB0|PGXC_ASPNG Exopolygalacturonase C OS=Aspergillus niger GN=pgxC PE=2 SV=1 49 392 5.0E-10
sp|O23147|ADPG1_ARATH Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1 149 438 1.0E-09
sp|P35336|PGLR_ACTDE Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1 67 437 2.0E-09
sp|Q9FY19|PGLR2_JUNAS Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 SV=1 117 439 1.0E-08
sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 157 441 1.0E-08
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 135 361 2.0E-08
sp|P35338|PGLR2_MAIZE Exopolygalacturonase OS=Zea mays GN=PG9 PE=2 SV=1 157 441 4.0E-08
sp|P26216|PGLR1_MAIZE Exopolygalacturonase OS=Zea mays GN=PG1 PE=1 SV=1 157 441 5.0E-08
sp|A1CVV8|PGLRA_NEOFI Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaA PE=3 SV=1 73 319 7.0E-08
sp|B0Y4Z4|PGLRA_ASPFC Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaA PE=3 SV=1 73 319 7.0E-08
sp|Q4WQT2|PGLRA_ASPFU Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaA PE=3 SV=1 73 319 7.0E-08
sp|O42824|PGLR_PENJA Polygalacturonase OS=Penicillium janthinellum PE=3 SV=1 148 445 4.0E-07
sp|I1BPS7|RPG13_RHIO9 Exopolygalacturonase rpg13 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg13 PE=1 SV=1 71 444 8.0E-07
sp|Q00446|PGLR1_COLLN Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum GN=PG1 PE=3 SV=1 135 366 1.0E-06
sp|Q70HJ4|PGLR2_ASPAC Probable endopolygalacturonase II OS=Aspergillus aculeatus GN=pgaII PE=2 SV=1 146 445 2.0E-06
sp|Q12554|PGLRC_ASPNG Probable endopolygalacturonase C OS=Aspergillus niger GN=pgaC PE=3 SV=1 135 306 3.0E-06
sp|A2QL39|PGLRC_ASPNC Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaC PE=3 SV=1 135 306 4.0E-06
sp|Q9P4W4|PGLRA_ASPNG Endopolygalacturonase A OS=Aspergillus niger GN=pgaA PE=1 SV=1 161 446 5.0E-06
sp|A2R8F8|PGLRA_ASPNC Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaA PE=3 SV=1 161 446 5.0E-06
sp|Q70HJ3|PGLRC_ASPAC Probable endopolygalacturonase C OS=Aspergillus aculeatus GN=pgaC PE=2 SV=1 137 306 8.0E-06
sp|P05117|PGLR_SOLLC Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1 182 438 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004650 polygalacturonase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|350
MRAVWLVTTVLLQWTAVAQPSRNGLESQPSRNGLESREADIGLPSEESVRRDAEAQGRELCVVRPLGQDKDDAPA
IVDALTRRCRSNSIVFLPGPVYNIRSAMTTEGLDDVHIVQLGRLLWSPDIEYWRSVSMPVGFQNQSTVWYFGGSS
IEWDGHGVGTFDGNGQVWYDWAQNRGNLARRPMNINFRGLSDSHIHRLRFVQSQMWTMAVTYSTNVDFDDIYVNN
TSSSQWNTLNTDGCDTIYSDSITFRRWFVTNGDDAIALKPNSTNISIYDSVFADGQGVAIGSVGQYNGQYDYISN
FYARNITLRNTAHVSYLKTWGGVSRGFPPNGGGGGLGQASDIVMEDITVDRLRQQPFFAWQCENYEGHLGEDCNS
SKYKLSRFAWRRVSGTVIDQVVETGHFQCSAAAGGCDDVEVSDINIQKVGGGRLDTWYCENVNGGSGFACNVAQD
KRMASSRAGPGPIFST*
Coding >OphauG2|350
ATGCGGGCTGTTTGGCTTGTGACGACGGTGCTGCTGCAGTGGACGGCTGTTGCGCAGCCTTCTCGGAATGGATTG
GAGTCGCAGCCTTCTCGGAATGGATTGGAGTCGCGAGAGGCAGACATTGGGCTGCCCAGCGAAGAGTCGGTGCGG
CGCGATGCCGAGGCGCAGGGCCGCGAGCTGTGTGTGGTTCGGCCGCTGGGGCAAGACAAGGACGATGCCCCAGCC
ATTGTGGACGCCCTGACGAGGCGGTGCCGCAGCAACAGCATCGTGTTCCTGCCCGGGCCGGTGTACAACATCCGC
AGTGCCATGACGACCGAGGGGCTGGACGACGTGCACATTGTGCAGCTGGGCCGGCTGCTGTGGAGCCCCGACATT
GAGTACTGGCGGTCGGTGTCGATGCCGGTGGGCTTCCAGAACCAGAGCACGGTGTGGTACTTTGGCGGGAGCAGC
ATTGAGTGGGACGGGCACGGCGTGGGCACCTTTGACGGCAACGGCCAGGTGTGGTACGACTGGGCGCAGAACAGG
GGCAACCTGGCGCGGCGGCCCATGAACATCAACTTCCGCGGGCTGAGCGACTCGCACATCCACCGGCTGCGCTTT
GTGCAGAGCCAGATGTGGACCATGGCCGTCACCTACTCCACCAACGTCGACTTTGACGACATCTACGTCAACAAC
ACGTCGAGCAGCCAGTGGAACACGCTCAACACGGACGGCTGCGACACCATCTACTCCGACTCCATTACCTTTCGC
CGCTGGTTCGTCACCAACGGCGACGACGCCATAGCCCTCAAGCCCAACTCGACCAACATTTCCATCTACGACAGC
GTCTTTGCCGACGGCCAGGGCGTGGCCATTGGCTCCGTCGGCCAGTACAACGGCCAGTACGACTACATCTCCAAC
TTTTACGCCCGCAACATCACCCTGCGCAACACGGCCCACGTGTCCTATCTCAAGACCTGGGGCGGCGTGTCGCGC
GGCTTCCCCCCCAACGGCGGCGGCGGCGGCCTGGGCCAAGCCAGCGACATAGTCATGGAGGACATTACCGTCGAC
CGTCTGCGCCAGCAGCCCTTTTTCGCGTGGCAGTGTGAAAACTACGAGGGCCACCTGGGCGAGGACTGCAACTCG
AGCAAGTACAAGCTCAGCCGCTTTGCCTGGCGCCGCGTCTCGGGCACCGTCATTGACCAAGTTGTTGAGACGGGG
CATTTCCAGTGCAGTGCGGCAGCGGGCGGCTGCGACGACGTCGAGGTTTCGGATATTAATATTCAAAAGGTGGGC
GGCGGCCGCCTCGACACGTGGTATTGCGAAAACGTCAATGGCGGCTCGGGCTTTGCCTGCAACGTGGCCCAGGAC
AAGCGCATGGCGAGCTCGAGGGCTGGGCCGGGGCCTATATTCTCGACGTAG
Transcript >OphauG2|350
ATGCGGGCTGTTTGGCTTGTGACGACGGTGCTGCTGCAGTGGACGGCTGTTGCGCAGCCTTCTCGGAATGGATTG
GAGTCGCAGCCTTCTCGGAATGGATTGGAGTCGCGAGAGGCAGACATTGGGCTGCCCAGCGAAGAGTCGGTGCGG
CGCGATGCCGAGGCGCAGGGCCGCGAGCTGTGTGTGGTTCGGCCGCTGGGGCAAGACAAGGACGATGCCCCAGCC
ATTGTGGACGCCCTGACGAGGCGGTGCCGCAGCAACAGCATCGTGTTCCTGCCCGGGCCGGTGTACAACATCCGC
AGTGCCATGACGACCGAGGGGCTGGACGACGTGCACATTGTGCAGCTGGGCCGGCTGCTGTGGAGCCCCGACATT
GAGTACTGGCGGTCGGTGTCGATGCCGGTGGGCTTCCAGAACCAGAGCACGGTGTGGTACTTTGGCGGGAGCAGC
ATTGAGTGGGACGGGCACGGCGTGGGCACCTTTGACGGCAACGGCCAGGTGTGGTACGACTGGGCGCAGAACAGG
GGCAACCTGGCGCGGCGGCCCATGAACATCAACTTCCGCGGGCTGAGCGACTCGCACATCCACCGGCTGCGCTTT
GTGCAGAGCCAGATGTGGACCATGGCCGTCACCTACTCCACCAACGTCGACTTTGACGACATCTACGTCAACAAC
ACGTCGAGCAGCCAGTGGAACACGCTCAACACGGACGGCTGCGACACCATCTACTCCGACTCCATTACCTTTCGC
CGCTGGTTCGTCACCAACGGCGACGACGCCATAGCCCTCAAGCCCAACTCGACCAACATTTCCATCTACGACAGC
GTCTTTGCCGACGGCCAGGGCGTGGCCATTGGCTCCGTCGGCCAGTACAACGGCCAGTACGACTACATCTCCAAC
TTTTACGCCCGCAACATCACCCTGCGCAACACGGCCCACGTGTCCTATCTCAAGACCTGGGGCGGCGTGTCGCGC
GGCTTCCCCCCCAACGGCGGCGGCGGCGGCCTGGGCCAAGCCAGCGACATAGTCATGGAGGACATTACCGTCGAC
CGTCTGCGCCAGCAGCCCTTTTTCGCGTGGCAGTGTGAAAACTACGAGGGCCACCTGGGCGAGGACTGCAACTCG
AGCAAGTACAAGCTCAGCCGCTTTGCCTGGCGCCGCGTCTCGGGCACCGTCATTGACCAAGTTGTTGAGACGGGG
CATTTCCAGTGCAGTGCGGCAGCGGGCGGCTGCGACGACGTCGAGGTTTCGGATATTAATATTCAAAAGGTGGGC
GGCGGCCGCCTCGACACGTGGTATTGCGAAAACGTCAATGGCGGCTCGGGCTTTGCCTGCAACGTGGCCCAGGAC
AAGCGCATGGCGAGCTCGAGGGCTGGGCCGGGGCCTATATTCTCGACGTAG
Gene >OphauG2|350
ATGCGGGCTGTTTGGCTTGTGACGACGGTGCTGCTGCAGTGGACGGCTGTTGCGCAGCCTTCTCGGAATGGATTG
GAGTCGCAGCCTTCTCGGAATGGATTGGAGTCGCGAGAGGCAGACATTGGGCTGCCCAGCGAAGAGTCGGTGCGG
CGCGATGCCGAGGCGCAGGGCCGCGAGCTGTGTGTGGTTCGGCCGCTGGGGCAAGACAAGGACGATGCCCCAGCC
ATTGTGGACGCCCTGACGAGGCGGTGCCGCAGCAACAGCATCGTGTTCCTGCCCGGGCCGGTGTACAACATCCGC
AGTGCCATGACGACCGAGGGGCTGGACGACGTGCACATTGTGCAGCTGGGCCGGCTGCTGTGGAGCCCCGACATT
GAGTACTGGCGGTCGGTGTCGATGCCGGTGGGCTTCCAGAACCAGAGCACGGTGTGGTACTTTGGCGGGAGCAGC
ATTGAGTGGGACGGGCACGGCGTGGGCACCTTTGACGGCAACGGCCAGGTGTGGTACGACTGGGCGCAGAACAGG
GGCAACCTGGCGCGGCGGCCCATGAACATCAACTTCCGCGGGCTGAGCGACTCGCACATCCACCGGCTGCGCTTT
GTGCAGAGCCAGATGTGGACCATGGCCGTCACCTACTCCACCAACGTCGACTTTGACGACATCTACGTCAACAAC
ACGTCGAGCAGCCAGTGGAACACGCTCAACACGGACGGCTGCGACACCATCTACTCCGACTCCATTACCTTTCGC
CGCTGGTTCGTCACCAACGGCGACGACGCCATAGCCCTCAAGCCCAACTCGACCAACATTTCCATCTACGACAGC
GTCTTTGCCGACGGCCAGGGCGTGGCCATTGGCTCCGTCGGCCAGTACAACGGCCAGTACGACTACATCTCCAAC
TTTTACGCCCGCAACATCACCCTGCGCAACACGGCCCACGTGTCCTATCTCAAGACCTGGGGCGGCGTGTCGCGC
GGCTTCCCCCCCAACGGCGGCGGCGGCGGCCTGGGCCAAGCCAGCGACATAGTCATGGAGGACATTACCGTCGAC
CGTCTGCGCCAGCAGCCCTTTTTCGCGTGGCAGTGTGAAAACTACGAGGGCCACCTGGGCGAGGACTGCAACTCG
AGCAAGTACAAGCTCAGCCGCTTTGCCTGGCGCCGCGTCTCGGGCACCGTCATTGACCAAGTTGTTGAGACGGGG
CATTTCCAGTGCAGTGCGGCAGCGGGCGGCTGCGACGACGTCGAGGTTTCGGATATTAATATTCAAAAGGTGGGC
GGCGGCCGCCTCGACACGTGGTATTGCGAAAACGTCAATGGCGGCTCGGGCTTTGCCTGCAACGTGGCCCAGGAC
AAGCGCATGGCGAGCTCGAGGGCTGGGCCGGGGCCTATATTCTCGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail