Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3497
Gene name
LocationContig_267:11374..13689
Strand-
Gene length (bp)2315
Transcript length (bp)1935
Coding sequence length (bp)1935
Protein length (aa) 645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 1.0E-07 441 491
PF15612 WHIM1 WSTF, HB1, Itc1p, MBD9 motif 1 6.9E-04 131 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C810|Y1342_ARATH PHD finger protein At1g33420 OS=Arabidopsis thaliana GN=At1g33420 PE=1 SV=1 415 489 1.0E-07
sp|Q9ZUA9|Y2181_ARATH PHD finger protein At2g01810 OS=Arabidopsis thaliana GN=At2g01810 PE=3 SV=1 435 489 2.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 273 396 3.0E-06
sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens GN=CECR2 PE=1 SV=2 36 196 6.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 296 434 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3497
MPTRKRPIAAVQGNNTEAEADHRDAEAKDQHTTTLLHRVRNMWQFANLCQWVYIFGKAAKIDDAIDIDEIEAACL
KPDSVLLADLALAILKLMSSHRGLTHDILDDQLRKQYLAKAPEKNPFGDVDTPRRFTDFDVVDKIKVLQQLTQWT
MLYSERIRDKMEEQKDTEQTSWRIEPYGWDREDRTYYVLDDNRIYRLTELPPVQAQPKTKRSKSARNGRRSSQRS
GAASDGLDTTQEEQSNNTETTDNGLGGQIWECLAITLQDVRDFLSGLDKTRDQNEKVLRRQLETHLIPILEKQEE
AQKRKELQKQRELMSLEKMANAKRSSRIAGRAEKQKQEEKAKEDEQMRKDADNAKRREEQQRLSMEKERDFRMFS
RQRRLQEREARRRQHQEELAQLSEDSRRASCGAGRVSERRLQAELDKNRQLLQDLEQEEEDWVFDCKCGLYGKVD
DGSHSVACERCNVWQHSQCLGIDQQEADGPNFSFICSPCQRRDEAAKSSPRAIIKLKLHSKTQRQMPDSGSEGDR
TITVATLETHGAGSGEQQTPDADTVLGYDTVTSRPFEVDDISIARLGPTNGTVEYKAETSKERTGPELQDSSHNS
STSPKELLSLQDVPEKNEGPLRCLEGGSRSNGQESSATVEARMA*
Coding >OphauG2|3497
ATGCCGACCCGTAAACGGCCTATTGCGGCCGTTCAAGGGAACAACACCGAGGCTGAGGCTGACCACAGAGATGCC
GAGGCCAAAGATCAGCATACCACAACGCTTCTGCATCGCGTCCGCAATATGTGGCAGTTTGCCAACCTCTGCCAA
TGGGTCTATATTTTTGGAAAAGCAGCAAAGATTGACGACGCCATTGACATCGACGAGATCGAGGCTGCTTGTCTC
AAGCCTGACTCGGTCTTGCTAGCAGATCTTGCACTCGCAATACTCAAGCTCATGTCTTCACATCGAGGGCTGACA
CACGATATTCTAGACGATCAACTCCGAAAGCAGTATCTAGCCAAGGCGCCAGAAAAGAATCCTTTTGGCGACGTC
GACACTCCCCGCAGATTCACTGATTTCGATGTCGTGGACAAGATTAAAGTATTGCAGCAACTAACCCAATGGACC
ATGCTCTATTCTGAGCGAATTCGTGACAAGATGGAAGAACAGAAGGATACAGAGCAGACAAGTTGGCGAATCGAG
CCATATGGTTGGGACCGTGAGGACCGTACCTACTACGTACTAGACGACAATCGTATCTATCGCTTGACGGAGCTT
CCCCCCGTTCAAGCCCAGCCCAAGACAAAAAGGAGCAAGTCTGCGCGCAACGGACGACGGTCAAGCCAGAGATCT
GGGGCAGCTAGCGATGGCCTTGATACGACCCAAGAGGAACAGAGCAACAATACTGAAACCACGGACAATGGTTTA
GGCGGGCAGATTTGGGAGTGCCTTGCCATCACTCTGCAGGATGTTCGCGATTTCCTCTCTGGTCTTGACAAGACT
CGAGACCAAAATGAGAAGGTGTTGCGTAGGCAACTAGAGACCCACCTTATCCCCATTTTGGAGAAGCAAGAGGAA
GCTCAGAAACGGAAGGAGCTTCAAAAACAACGGGAGCTCATGAGCCTGGAAAAGATGGCAAACGCCAAGAGATCG
AGTCGCATCGCGGGCAGAGCGGAAAAACAGAAACAGGAGGAAAAGGCCAAGGAAGATGAGCAAATGCGCAAAGAT
GCCGATAATGCGAAACGCCGCGAAGAACAGCAACGGCTGTCGATGGAAAAGGAGCGCGATTTTCGCATGTTTTCC
CGTCAGCGCCGGTTACAGGAGCGAGAGGCTCGTCGACGACAGCACCAAGAAGAATTGGCGCAATTATCCGAGGAC
AGTCGCCGGGCATCATGTGGAGCAGGACGCGTGTCAGAACGGCGTCTGCAAGCCGAGCTGGATAAGAATAGGCAG
CTGCTGCAGGATCTTGAGCAAGAGGAGGAGGACTGGGTTTTTGATTGCAAATGCGGACTTTACGGCAAGGTTGAC
GACGGATCGCATAGCGTCGCCTGTGAGCGATGCAACGTTTGGCAGCATAGCCAGTGCCTAGGTATTGATCAGCAA
GAGGCCGATGGGCCTAATTTTAGTTTCATCTGCAGCCCTTGCCAGCGCCGCGATGAAGCCGCCAAATCATCGCCT
CGAGCAATCATCAAACTCAAACTTCACTCAAAGACTCAGCGACAGATGCCAGACTCTGGATCTGAAGGGGATAGA
ACCATTACAGTGGCGACGTTGGAGACGCATGGGGCTGGATCCGGCGAGCAGCAGACGCCTGACGCCGATACAGTG
CTCGGTTATGACACAGTCACTTCTCGGCCATTCGAGGTTGATGACATTAGCATTGCGCGTCTTGGACCGACAAAT
GGGACTGTGGAGTACAAGGCAGAAACAAGCAAAGAGCGCACCGGTCCTGAGCTCCAGGACAGTTCTCACAACTCG
AGCACAAGTCCCAAAGAGCTGCTTTCACTACAAGACGTCCCTGAGAAAAACGAAGGGCCGCTGCGTTGCTTGGAA
GGGGGCTCGCGTTCAAATGGACAGGAGTCAAGCGCAACTGTCGAGGCGAGAATGGCCTAG
Transcript >OphauG2|3497
ATGCCGACCCGTAAACGGCCTATTGCGGCCGTTCAAGGGAACAACACCGAGGCTGAGGCTGACCACAGAGATGCC
GAGGCCAAAGATCAGCATACCACAACGCTTCTGCATCGCGTCCGCAATATGTGGCAGTTTGCCAACCTCTGCCAA
TGGGTCTATATTTTTGGAAAAGCAGCAAAGATTGACGACGCCATTGACATCGACGAGATCGAGGCTGCTTGTCTC
AAGCCTGACTCGGTCTTGCTAGCAGATCTTGCACTCGCAATACTCAAGCTCATGTCTTCACATCGAGGGCTGACA
CACGATATTCTAGACGATCAACTCCGAAAGCAGTATCTAGCCAAGGCGCCAGAAAAGAATCCTTTTGGCGACGTC
GACACTCCCCGCAGATTCACTGATTTCGATGTCGTGGACAAGATTAAAGTATTGCAGCAACTAACCCAATGGACC
ATGCTCTATTCTGAGCGAATTCGTGACAAGATGGAAGAACAGAAGGATACAGAGCAGACAAGTTGGCGAATCGAG
CCATATGGTTGGGACCGTGAGGACCGTACCTACTACGTACTAGACGACAATCGTATCTATCGCTTGACGGAGCTT
CCCCCCGTTCAAGCCCAGCCCAAGACAAAAAGGAGCAAGTCTGCGCGCAACGGACGACGGTCAAGCCAGAGATCT
GGGGCAGCTAGCGATGGCCTTGATACGACCCAAGAGGAACAGAGCAACAATACTGAAACCACGGACAATGGTTTA
GGCGGGCAGATTTGGGAGTGCCTTGCCATCACTCTGCAGGATGTTCGCGATTTCCTCTCTGGTCTTGACAAGACT
CGAGACCAAAATGAGAAGGTGTTGCGTAGGCAACTAGAGACCCACCTTATCCCCATTTTGGAGAAGCAAGAGGAA
GCTCAGAAACGGAAGGAGCTTCAAAAACAACGGGAGCTCATGAGCCTGGAAAAGATGGCAAACGCCAAGAGATCG
AGTCGCATCGCGGGCAGAGCGGAAAAACAGAAACAGGAGGAAAAGGCCAAGGAAGATGAGCAAATGCGCAAAGAT
GCCGATAATGCGAAACGCCGCGAAGAACAGCAACGGCTGTCGATGGAAAAGGAGCGCGATTTTCGCATGTTTTCC
CGTCAGCGCCGGTTACAGGAGCGAGAGGCTCGTCGACGACAGCACCAAGAAGAATTGGCGCAATTATCCGAGGAC
AGTCGCCGGGCATCATGTGGAGCAGGACGCGTGTCAGAACGGCGTCTGCAAGCCGAGCTGGATAAGAATAGGCAG
CTGCTGCAGGATCTTGAGCAAGAGGAGGAGGACTGGGTTTTTGATTGCAAATGCGGACTTTACGGCAAGGTTGAC
GACGGATCGCATAGCGTCGCCTGTGAGCGATGCAACGTTTGGCAGCATAGCCAGTGCCTAGGTATTGATCAGCAA
GAGGCCGATGGGCCTAATTTTAGTTTCATCTGCAGCCCTTGCCAGCGCCGCGATGAAGCCGCCAAATCATCGCCT
CGAGCAATCATCAAACTCAAACTTCACTCAAAGACTCAGCGACAGATGCCAGACTCTGGATCTGAAGGGGATAGA
ACCATTACAGTGGCGACGTTGGAGACGCATGGGGCTGGATCCGGCGAGCAGCAGACGCCTGACGCCGATACAGTG
CTCGGTTATGACACAGTCACTTCTCGGCCATTCGAGGTTGATGACATTAGCATTGCGCGTCTTGGACCGACAAAT
GGGACTGTGGAGTACAAGGCAGAAACAAGCAAAGAGCGCACCGGTCCTGAGCTCCAGGACAGTTCTCACAACTCG
AGCACAAGTCCCAAAGAGCTGCTTTCACTACAAGACGTCCCTGAGAAAAACGAAGGGCCGCTGCGTTGCTTGGAA
GGGGGCTCGCGTTCAAATGGACAGGAGTCAAGCGCAACTGTCGAGGCGAGAATGGCCTAG
Gene >OphauG2|3497
ATGCCGACCCGTAAACGGCCTATTGCGGCCGTTCAAGGGAACAACACCGAGGCTGAGGCTGACCACAGAGATGCC
GAGGCCAAAGATCAGCATACCACAACGCTTCTGCATCGCGTCCGCAATATGTGGCAGTTTGCCAACCTCTGCCAA
TGGGTCTATATTTTTGGAAAAGCAGCAAAGATTGACGACGCCATTGACATCGACGTGAGCCGGCCTCGTGCATTC
CCTGCCATTTATACCTTGGCACTAATACTGGTCATTTCGCGTTACAGGAGATCGAGGCTGCTTGTCTCAAGCCTG
ACTCGGTCTTGCTAGCAGATCTTGCACTCGCAATACTCAAGCTCATGTCTTCACATCGAGGGCTGACGTATGAAC
ACCACTTTTTGTCCTCTTGCAGCTTGTCATTGGCCTGGCCCTTGTCGATATTAACCAGTCTCTCTTTTTGTAGAC
ACGATATTCTAGACGATCAACTCCGAAAGCAGTATCTAGCCAAGGCGCCAGAAAAGAATCCTTTTGGCGACGTCG
ACACTCCCCGCAGATTCACTGATTTCGATGTCGTGGACAAGGTATGTACTCGCCTAATTGTTGCTTTCCCCTGCA
TGATGCAATGTGTCATCTAAATATAATTTGTAGCCTTTTGCTGACACGTTCCAACTCGACCCCTTCTTGCTTAGA
TTAAAGTATTGCAGCAACTAACCCAATGGACCATGCTCTATTCTGAGCGAATTCGTGACAAGATGGAAGAACAGA
AGGATACAGAGCAGACAAGTTGGGTATTGATATTGGCCCCTTTCCTTTCCCACTCGTGTTCTTGCTTGCTGACAC
GCACAATAAAGCGAATCGAGCCATATGGTTGGGACCGTGAGGACCGTACCTACTACGTACTAGACGACAATCGTA
TCTATCGCTTGACGGAGCTTCCCCCCGTTCAAGCCCAGCCCAAGACAAAAAGGAGCAAGTCTGCGCGCAACGGAC
GACGGTCAAGCCAGAGATCTGGGGCAGCTAGCGATGGCCTTGATACGACCCAAGAGGAACAGAGCAACAATACTG
AAACCACGGACAATGGTTTAGGCGGGCAGATTTGGGAGTGCCTTGCCATCACTCTGCAGGATGTTCGCGATTTCC
TCTCTGGTCTTGACAAGACTCGAGACCAAAATGAGAAGGTGTTGCGTAGGCAACTAGAGACCCACCTTATCCCCA
TTTTGGAGAAGCAAGAGGAAGCTCAGAAACGGAAGGAGCTTCAAAAACAACGGGAGCTCATGAGCCTGGAAAAGA
TGGCAAACGCCAAGAGATCGAGTCGCATCGCGGGCAGAGCGGAAAAACAGAAACAGGAGGAAAAGGCCAAGGAAG
ATGAGCAAATGCGCAAAGATGCCGATAATGCGAAACGCCGCGAAGAACAGCAACGGCTGTCGATGGAAAAGGAGC
GCGATTTTCGCATGTTTTCCCGTCAGCGCCGGTTACAGGAGCGAGAGGCTCGTCGACGACAGCACCAAGAAGAAT
TGGCGCAATTATCCGAGGACAGTCGCCGGGCATCATGTGGAGCAGGACGCGTGTCAGAACGGCGTCTGCAAGCCG
AGCTGGATAAGAATAGGCAGCTGCTGCAGGATCTTGAGCAAGAGGAGGAGGACTGGGTTTTTGATTGCAAATGCG
GACTTTACGGCAAGGTTGACGACGGATCGCATAGCGTCGCCTGTGAGCGATGCAACGTTTGGCAGCATAGCCAGT
GCCTAGGTATTGATCAGCAAGAGGCCGATGGGCCTAATTTTAGTTTCATCTGCAGCCCTTGCCAGCGCCGCGATG
AAGCCGCCAAATCATCGCCTCGAGCAATCATCAAACTCAAACTTCACTCAAAGGTTTGCACCGATATGTATGCGC
AGCCCAGCCCCGTCTCAAGTAGCTCATTGGCAGCCCAGACTCAGCGACAGATGCCAGACTCTGGATCTGAAGGGG
ATAGAACCATTACAGTGGCGACGTTGGAGACGCATGGGGCTGGATCCGGCGAGCAGCAGACGCCTGACGCCGATA
CAGTGCTCGGTTATGACACAGTCACTTCTCGGCCATTCGAGGTTGATGACATTAGCATTGCGCGTCTTGGACCGA
CAAATGGGACTGTGGAGTACAAGGCAGAAACAAGCAAAGAGCGCACCGGTCCTGAGCTCCAGGACAGTTCTCACA
ACTCGAGCACAAGTCCCAAAGAGCTGCTTTCACTACAAGACGTCCCTGAGAAAAACGAAGGGCCGCTGCGTTGCT
TGGAAGGGGGCTCGCGTTCAAATGGACAGGAGTCAAGCGCAACTGTCGAGGCGAGAATGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail