Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3488
Gene name
LocationContig_266:11732..14137
Strand+
Gene length (bp)2405
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01031 Dynamin_M Dynamin central region 2.7E-101 243 528
PF00350 Dynamin_N Dynamin family 1.2E-55 41 235
PF02212 GED Dynamin GTPase effector domain 4.3E-29 608 699
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-04 40 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URZ5|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2 13 699 0.0E+00
sp|P21576|VPS1_YEAST Vacuolar protein sorting-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS1 PE=1 SV=2 13 699 0.0E+00
sp|Q7SXN5|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1 15 700 0.0E+00
sp|O00429|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2 15 700 0.0E+00
sp|Q2KIA5|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1 15 700 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URZ5|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2 13 699 0.0E+00
sp|P21576|VPS1_YEAST Vacuolar protein sorting-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS1 PE=1 SV=2 13 699 0.0E+00
sp|Q7SXN5|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1 15 700 0.0E+00
sp|O00429|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2 15 700 0.0E+00
sp|Q2KIA5|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1 15 700 0.0E+00
sp|Q8K1M6|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2 15 700 0.0E+00
sp|Q8LFT2|DRP3B_ARATH Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2 2 699 0.0E+00
sp|O35303|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1 15 700 0.0E+00
sp|Q8S944|DRP3A_ARATH Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2 6 692 0.0E+00
sp|P54861|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1 16 699 2.0E-180
sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 16 523 2.0E-180
sp|Q09748|DNM1_SCHPO Dynamin-related protein dnm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dnm1 PE=3 SV=1 16 533 5.0E-162
sp|P39053|DYN1_MOUSE Dynamin-1 OS=Mus musculus GN=Dnm1 PE=1 SV=2 10 532 5.0E-154
sp|Q05193|DYN1_HUMAN Dynamin-1 OS=Homo sapiens GN=DNM1 PE=1 SV=2 10 532 6.0E-154
sp|P21575|DYN1_RAT Dynamin-1 OS=Rattus norvegicus GN=Dnm1 PE=1 SV=2 10 532 2.0E-152
sp|Q08DF4|DYN1_BOVIN Dynamin-1 OS=Bos taurus GN=DNM1 PE=2 SV=1 10 532 7.0E-152
sp|A6H7I5|DYN2_BOVIN Dynamin-2 OS=Bos taurus GN=DNM2 PE=2 SV=1 16 521 7.0E-150
sp|P39054|DYN2_MOUSE Dynamin-2 OS=Mus musculus GN=Dnm2 PE=1 SV=2 16 521 2.0E-149
sp|P39052|DYN2_RAT Dynamin-2 OS=Rattus norvegicus GN=Dnm2 PE=1 SV=1 16 521 4.0E-149
sp|P50570|DYN2_HUMAN Dynamin-2 OS=Homo sapiens GN=DNM2 PE=1 SV=2 16 521 8.0E-149
sp|P39055|DYN1_CAEEL Dynamin OS=Caenorhabditis elegans GN=dyn-1 PE=1 SV=3 15 528 8.0E-147
sp|P27619|DYN_DROME Dynamin OS=Drosophila melanogaster GN=shi PE=1 SV=2 15 521 8.0E-144
sp|Q9UQ16|DYN3_HUMAN Dynamin-3 OS=Homo sapiens GN=DNM3 PE=1 SV=4 16 521 2.0E-142
sp|Q08877|DYN3_RAT Dynamin-3 OS=Rattus norvegicus GN=Dnm3 PE=1 SV=2 16 521 2.0E-142
sp|Q8BZ98|DYN3_MOUSE Dynamin-3 OS=Mus musculus GN=Dnm3 PE=1 SV=1 16 521 4.0E-142
sp|Q9U1M9|DYNB_DICDI Dynamin-B OS=Dictyostelium discoideum GN=dymB PE=3 SV=1 15 521 2.0E-124
sp|Q84XF3|DRP1B_ARATH Dynamin-related protein 1B OS=Arabidopsis thaliana GN=DRP1B PE=1 SV=1 15 514 3.0E-96
sp|P42697|DRP1A_ARATH Dynamin-related protein 1A OS=Arabidopsis thaliana GN=DRP1A PE=1 SV=3 16 537 7.0E-94
sp|Q9FNX5|DRP1E_ARATH Dynamin-related protein 1E OS=Arabidopsis thaliana GN=DRP1E PE=1 SV=1 15 699 2.0E-93
sp|Q8LF21|DRP1C_ARATH Dynamin-related protein 1C OS=Arabidopsis thaliana GN=DRP1C PE=1 SV=2 15 513 3.0E-93
sp|Q39821|SDLCA_SOYBN Dynamin-related protein 12A OS=Glycine max PE=1 SV=1 16 537 4.0E-93
sp|Q39828|SDL5A_SOYBN Dynamin-related protein 5A OS=Glycine max PE=2 SV=1 16 537 7.0E-93
sp|Q8S3C9|DRP1D_ARATH Dynamin-related protein 1D OS=Arabidopsis thaliana GN=DRP1D PE=2 SV=2 15 547 1.0E-91
sp|P79135|MX1_BOVIN Interferon-induced GTP-binding protein Mx1 OS=Bos taurus GN=MX1 PE=2 SV=4 23 472 2.0E-72
sp|P27594|MX1_PIG Interferon-induced GTP-binding protein Mx1 OS=Sus scrofa GN=MX1 PE=2 SV=1 23 463 3.0E-71
sp|P20591|MX1_HUMAN Interferon-induced GTP-binding protein Mx1 OS=Homo sapiens GN=MX1 PE=1 SV=4 23 463 1.0E-68
sp|P33237|MX1_SHEEP Interferon-induced GTP-binding protein Mx1 OS=Ovis aries GN=MX1 PE=1 SV=1 23 472 1.0E-68
sp|Q9N0Y3|MX1_CANLF Interferon-induced GTP-binding protein Mx1 OS=Canis lupus familiaris GN=MX1 PE=2 SV=1 23 494 1.0E-68
sp|Q5R5G3|MX1_PONAB Interferon-induced GTP-binding protein Mx1 OS=Pongo abelii GN=MX1 PE=2 SV=1 23 463 9.0E-68
sp|Q6TKS7|MX_CTEID Interferon-induced GTP-binding protein Mx OS=Ctenopharyngodon idella GN=mx PE=2 SV=1 23 514 1.0E-66
sp|A1E2I4|MX1_MACMU Interferon-induced GTP-binding protein Mx1 OS=Macaca mulatta GN=MX1 PE=2 SV=1 23 463 2.0E-66
sp|Q6PW23|MX_EPICO Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides GN=mx PE=2 SV=1 23 467 2.0E-66
sp|Q28379|MX1_HORSE Interferon-induced GTP-binding protein Mx1 OS=Equus caballus GN=MX1 PE=2 SV=1 23 462 5.0E-66
sp|Q4ADG6|MX1_PHOVI Interferon-induced GTP-binding protein Mx1 OS=Phoca vitulina GN=MX1 PE=2 SV=1 23 494 1.0E-65
sp|Q5U752|MX_SOLSE Interferon-induced GTP-binding protein Mx OS=Solea senegalensis GN=mx PE=2 SV=1 23 467 6.0E-65
sp|Q800G5|MXE_DANRE Interferon-induced GTP-binding protein MxE OS=Danio rerio GN=mxe PE=2 SV=1 23 458 4.0E-64
sp|Q91197|MX3_ONCMY Interferon-induced GTP-binding protein Mx3 OS=Oncorhynchus mykiss GN=mx3 PE=2 SV=1 23 479 4.0E-64
sp|P20592|MX2_HUMAN Interferon-induced GTP-binding protein Mx2 OS=Homo sapiens GN=MX2 PE=1 SV=1 23 470 4.0E-64
sp|Q91192|MX1_ONCMY Interferon-induced GTP-binding protein Mx1 OS=Oncorhynchus mykiss GN=mx1 PE=2 SV=1 23 479 1.0E-63
sp|Q800G8|MXB_DANRE Interferon-induced GTP-binding protein MxB OS=Danio rerio GN=mxb PE=2 SV=2 25 467 3.0E-63
sp|Q6TN15|MX_SINCH Interferon-induced GTP-binding protein Mx OS=Siniperca chuatsi GN=mx PE=2 SV=1 23 479 4.0E-63
sp|P18590|MX3_RAT Interferon-induced GTP-binding protein Mx3 OS=Rattus norvegicus GN=Mx3 PE=2 SV=1 23 462 9.0E-63
sp|Q8JH68|MXA_DANRE Interferon-induced GTP-binding protein MxA OS=Danio rerio GN=mxa PE=2 SV=1 25 486 1.0E-62
sp|A1E2I5|MX2_MACMU Interferon-induced GTP-binding protein Mx2 OS=Macaca mulatta GN=MX2 PE=2 SV=1 23 494 1.0E-62
sp|Q9WVP9|MX2_MOUSE Interferon-induced GTP-binding protein Mx2 OS=Mus musculus GN=Mx2 PE=2 SV=2 23 494 2.0E-62
sp|Q9BDI7|MX2_BOVIN Interferon-induced GTP-binding protein Mx2 OS=Bos taurus GN=MX2 PE=2 SV=1 23 509 3.0E-62
sp|P18589|MX2_RAT Interferon-induced GTP-binding protein Mx2 OS=Rattus norvegicus GN=Mx2 PE=2 SV=1 23 462 4.0E-62
sp|P09922|MX1_MOUSE Interferon-induced GTP-binding protein Mx1 OS=Mus musculus GN=Mx1 PE=1 SV=1 23 469 6.0E-62
sp|Q91196|MX2_ONCMY Interferon-induced GTP-binding protein Mx2 OS=Oncorhynchus mykiss GN=mx2 PE=2 SV=1 23 458 6.0E-62
sp|Q5I2P5|MX2_SHEEP Interferon-induced GTP-binding protein Mx2 OS=Ovis aries GN=MX2 PE=2 SV=1 23 454 8.0E-62
sp|P18588|MX1_RAT Interferon-induced GTP-binding protein Mx1 OS=Rattus norvegicus GN=Mx1 PE=1 SV=1 23 509 1.0E-61
sp|Q9N0Y2|MX2_CANLF Interferon-induced GTP-binding protein Mx2 OS=Canis lupus familiaris GN=MX2 PE=2 SV=1 23 509 2.0E-61
sp|Q000A9|MX_LARCR Interferon-induced GTP-binding protein Mx OS=Larimichthys crocea GN=mx PE=2 SV=1 23 509 3.0E-61
sp|Q4U4N4|MX2_ICTPU Interferon-induced GTP-binding protein Mx2 OS=Ictalurus punctatus GN=mx2 PE=2 SV=1 23 467 2.0E-60
sp|Q90597|MX_CHICK Interferon-induced GTP-binding protein Mx OS=Gallus gallus GN=MX PE=2 SV=1 17 463 5.0E-60
sp|A7VK00|MX2_PIG Interferon-induced GTP-binding protein Mx2 OS=Sus scrofa GN=MX2 PE=2 SV=1 23 462 6.0E-60
sp|Q2KTC2|MX_DICLA Interferon-induced GTP-binding protein Mx OS=Dicentrarchus labrax GN=mx PE=2 SV=2 23 463 1.0E-59
sp|Q7T2P0|MX1_ICTPU Interferon-induced GTP-binding protein Mx1 OS=Ictalurus punctatus GN=mx1 PE=2 SV=1 23 509 5.0E-59
sp|Q4ADG7|MX1_OTABY Interferon-induced GTP-binding protein Mx1 OS=Otaria byronia GN=MX1 PE=2 SV=1 23 494 7.0E-59
sp|P20593|MX_PERFL Interferon-induced GTP-binding protein Mx (Fragment) OS=Perca fluviatilis GN=mx PE=2 SV=1 23 318 1.0E-58
sp|Q4ADG8|MX1_EUMJU Interferon-induced GTP-binding protein Mx1 OS=Eumetopias jubatus GN=MX1 PE=2 SV=1 23 494 2.0E-58
sp|Q6DKF0|MXC_DANRE Interferon-induced GTP-binding protein MxC OS=Danio rerio GN=mxc PE=2 SV=1 23 451 1.0E-57
sp|P33238|MX_ANAPL Interferon-induced GTP-binding protein Mx OS=Anas platyrhynchos GN=MX PE=2 SV=1 23 466 2.0E-57
sp|A0MWD1|MX2_BUBBU Interferon-induced GTP-binding protein Mx2 OS=Bubalus bubalis GN=MX2 PE=2 SV=1 23 509 3.0E-57
sp|Q9ZP55|DRP4C_ARATH Dynamin-related protein 4C OS=Arabidopsis thaliana GN=DRP4C PE=2 SV=1 36 699 4.0E-49
sp|P87320|MSP1_SCHPO Protein msp1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msp1 PE=3 SV=2 16 334 1.0E-44
sp|P32266|MGM1_YEAST Dynamin-like GTPase MGM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGM1 PE=1 SV=3 36 273 3.0E-42
sp|Q9ZP56|DRP4A_ARATH Putative dynamin-related protein 4A OS=Arabidopsis thaliana GN=DRP4A PE=5 SV=1 36 265 1.0E-39
sp|O60313|OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens GN=OPA1 PE=1 SV=3 15 291 1.0E-24
sp|Q5RAM3|OPA1_PONAB Dynamin-like 120 kDa protein, mitochondrial OS=Pongo abelii GN=OPA1 PE=2 SV=1 15 291 1.0E-24
sp|Q2TA68|OPA1_RAT Dynamin-like 120 kDa protein, mitochondrial OS=Rattus norvegicus GN=Opa1 PE=1 SV=1 15 291 1.0E-24
sp|P58281|OPA1_MOUSE Dynamin-like 120 kDa protein, mitochondrial OS=Mus musculus GN=Opa1 PE=1 SV=1 15 291 1.0E-24
sp|Q5U3A7|OPA1_DANRE Dynamin-like 120 kDa protein, mitochondrial OS=Danio rerio GN=opa1 PE=2 SV=1 15 295 5.0E-24
sp|Q5F499|OPA1_CHICK Dynamin-like 120 kDa protein, mitochondrial OS=Gallus gallus GN=OPA1 PE=2 SV=1 15 291 5.0E-23
sp|O93248|OPA1_ONCMA Dynamin-like 120 kDa protein, mitochondrial OS=Oncorhynchus masou GN=opa1 PE=2 SV=1 15 295 2.0E-22
sp|Q55AX0|DLPC_DICDI Dynamin-like protein C OS=Dictyostelium discoideum GN=dlpC PE=2 SV=2 12 236 2.0E-19
sp|Q9SE83|DRP2A_ARATH Dynamin-2A OS=Arabidopsis thaliana GN=DRP2A PE=1 SV=2 24 517 2.0E-18
sp|Q9LQ55|DRP2B_ARATH Dynamin-2B OS=Arabidopsis thaliana GN=DRP2B PE=1 SV=2 41 517 2.0E-17
sp|Q09748|DNM1_SCHPO Dynamin-related protein dnm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dnm1 PE=3 SV=1 605 699 1.0E-15
sp|F4HPR5|DRP5A_ARATH Dynamin-related protein 5A OS=Arabidopsis thaliana GN=DRP5A PE=2 SV=1 17 236 6.0E-15
sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 588 700 1.0E-12
sp|P39055|DYN1_CAEEL Dynamin OS=Caenorhabditis elegans GN=dyn-1 PE=1 SV=3 612 699 1.0E-08
sp|Q55F94|DLPA_DICDI Dynamin-like protein A OS=Dictyostelium discoideum GN=dlpA PE=2 SV=1 22 268 3.0E-08
sp|P27619|DYN_DROME Dynamin OS=Drosophila melanogaster GN=shi PE=1 SV=2 612 699 1.0E-07
sp|Q8BZ98|DYN3_MOUSE Dynamin-3 OS=Mus musculus GN=Dnm3 PE=1 SV=1 612 699 7.0E-07
sp|Q9UQ16|DYN3_HUMAN Dynamin-3 OS=Homo sapiens GN=DNM3 PE=1 SV=4 612 699 9.0E-07
sp|P39053|DYN1_MOUSE Dynamin-1 OS=Mus musculus GN=Dnm1 PE=1 SV=2 612 699 1.0E-06
sp|Q05193|DYN1_HUMAN Dynamin-1 OS=Homo sapiens GN=DNM1 PE=1 SV=2 612 699 1.0E-06
sp|P21575|DYN1_RAT Dynamin-1 OS=Rattus norvegicus GN=Dnm1 PE=1 SV=2 612 699 1.0E-06
sp|Q08DF4|DYN1_BOVIN Dynamin-1 OS=Bos taurus GN=DNM1 PE=2 SV=1 612 699 1.0E-06
sp|Q08877|DYN3_RAT Dynamin-3 OS=Rattus norvegicus GN=Dnm3 PE=1 SV=2 612 699 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4605
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3488 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1674
Ophiocordyceps camponoti-floridani Ophcf2|04898
Ophiocordyceps camponoti-rufipedis Ophun1|5010
Ophiocordyceps kimflemingae Ophio5|5194
Ophiocordyceps subramaniannii Hirsu2|9660

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3488
MSNTLATPGGISDPALIQLVNKLQDVFATVGVNNPIDLPQIAVVGSQSSGKSSVLENIVGRDFLPRGAGICTRRP
LVLQLINRPAQTNGVSQEQVSTATDKAANPDEWGEFLHIPGQKYHDFTKIREEIARETEAKVGKNAGISPAPINL
RIYSPNVLTLTLVDLPGLTKVPVGDQPRDIERQIREMVLKYIGKSNAIILAVTAANIDLANSDGLKLAREVDPEG
QRTIGVLTKVDLMDEGTDVIDILSNRVIPLRLGYVPVVNRGQRDIDNKKAINVALDAEKAFFENHKAYRNKSSYC
GTPYLARKLNLILMMHIKQTLPDIKARIASSLQKYSSELESLGPSMLGNSANIVLNIITEFINEWRTVLDGNNTE
LSSTELSGGARISFVFHELYANGVKALDPFDVVKDVDIRTILYNSSGSSPALFVGTTAFELIVKQQIKRMEDPSL
KCVSLVYDELVRILSQLLGKQLYRRYPSLKEKMHGVVISFFKKAMEPTNKLVRDLVSMEACYINTGHPDFLNGHR
AMAIVNERYNPSKPVQVDPKTGKPLAQSSTPARAASPTVPVNDMDGNNSGFFGSFFAAKNKKKAAAMDAPPPTLK
ASGTLSERENIEVEVIKLLISSYYNITKRTMIDMVPKAIMLTLVQFTKDEMQRELLENMYRTDQLDDLLKESDFT
IRRRKECQQMVESLSKASEIVSQVQ*
Coding >OphauG2|3488
ATGAGCAACACCCTCGCGACGCCGGGTGGCATCTCGGATCCAGCCTTGATCCAACTCGTCAACAAGCTCCAAGAT
GTCTTTGCGACAGTTGGCGTCAATAATCCCATCGATCTCCCTCAAATTGCTGTTGTGGGTAGTCAGTCGAGTGGA
AAGAGCTCAGTACTGGAAAACATTGTCGGGCGTGACTTCTTGCCTCGAGGCGCCGGCATCTGTACTCGTCGCCCC
CTTGTCCTTCAACTCATCAACCGCCCTGCACAAACAAACGGCGTCTCACAAGAACAAGTCTCTACCGCGACAGAC
AAAGCTGCGAATCCAGATGAGTGGGGGGAGTTTCTCCATATACCTGGCCAAAAATATCACGACTTTACCAAGATA
CGAGAAGAGATTGCCCGCGAGACGGAAGCCAAGGTTGGCAAGAATGCTGGAATATCGCCTGCCCCTATAAACCTG
CGCATTTACTCGCCTAATGTTCTGACCCTTACGCTCGTTGATCTTCCCGGCCTGACCAAGGTGCCGGTGGGCGAT
CAACCGCGCGACATCGAACGGCAAATCCGAGAAATGGTGCTCAAGTACATTGGCAAGTCCAATGCCATTATTCTC
GCCGTGACGGCGGCCAATATCGATCTAGCCAACTCGGATGGCTTGAAGCTGGCGCGCGAGGTCGACCCTGAAGGC
CAAAGAACCATTGGTGTCTTGACAAAGGTGGACCTGATGGACGAAGGAACCGACGTTATCGACATTTTATCTAAC
CGTGTGATTCCACTGCGGCTGGGATACGTGCCTGTAGTCAATAGAGGACAGCGTGATATTGACAACAAAAAGGCA
ATCAATGTGGCTCTGGATGCAGAAAAGGCTTTCTTCGAGAACCACAAGGCCTACCGCAACAAGAGCTCCTACTGT
GGCACGCCTTATCTAGCCCGCAAGCTCAACCTTATCCTCATGATGCACATCAAACAGACACTGCCTGATATCAAG
GCAAGGATTGCTAGCTCGCTGCAAAAGTATTCGAGTGAGCTTGAGTCTCTGGGCCCGTCGATGCTGGGCAACAGT
GCCAACATTGTCCTCAACATCATCACCGAATTTATCAATGAGTGGCGCACTGTACTCGACGGAAACAACACGGAG
CTATCCAGTACAGAGCTGTCTGGCGGTGCACGCATCAGCTTCGTCTTCCACGAGCTTTACGCCAATGGCGTCAAG
GCTCTGGATCCTTTTGACGTAGTCAAGGATGTCGACATTCGCACCATATTGTATAACTCATCAGGCTCCTCCCCT
GCTCTTTTTGTTGGCACAACAGCCTTTGAACTCATTGTCAAGCAGCAAATCAAACGCATGGAAGATCCCAGTCTC
AAGTGCGTGTCGCTGGTATACGATGAGCTGGTGCGCATACTGTCACAACTTCTGGGCAAGCAGCTGTACCGCCGC
TACCCTTCACTCAAAGAAAAGATGCATGGTGTTGTGATATCCTTTTTCAAAAAGGCCATGGAGCCCACCAATAAG
CTGGTCCGTGATCTTGTTTCTATGGAGGCTTGCTACATCAACACGGGCCATCCAGACTTTCTCAATGGGCATCGA
GCCATGGCCATTGTGAACGAGCGGTATAACCCCTCAAAGCCAGTGCAGGTGGATCCCAAAACAGGCAAGCCACTG
GCGCAGTCATCGACGCCCGCTAGAGCTGCTAGCCCTACAGTTCCTGTCAACGACATGGATGGAAATAATTCTGGC
TTCTTTGGCAGCTTCTTCGCCGCCAAGAACAAGAAAAAGGCGGCCGCTATGGATGCGCCGCCTCCGACCCTCAAG
GCCTCGGGAACATTGTCTGAGCGCGAAAACATTGAGGTGGAGGTCATCAAGCTTCTTATTTCGTCATACTACAAC
ATTACTAAACGCACAATGATTGACATGGTGCCCAAGGCCATCATGCTGACTCTTGTCCAATTTACCAAGGACGAG
ATGCAGCGCGAGTTACTGGAAAACATGTATAGGACAGACCAGTTGGACGACTTGCTGAAGGAGAGTGACTTTACC
ATTCGCAGACGGAAAGAGTGCCAGCAGATGGTCGAGTCGCTATCCAAGGCAAGCGAGATTGTCAGCCAGGTTCAG
TAA
Transcript >OphauG2|3488
ATGAGCAACACCCTCGCGACGCCGGGTGGCATCTCGGATCCAGCCTTGATCCAACTCGTCAACAAGCTCCAAGAT
GTCTTTGCGACAGTTGGCGTCAATAATCCCATCGATCTCCCTCAAATTGCTGTTGTGGGTAGTCAGTCGAGTGGA
AAGAGCTCAGTACTGGAAAACATTGTCGGGCGTGACTTCTTGCCTCGAGGCGCCGGCATCTGTACTCGTCGCCCC
CTTGTCCTTCAACTCATCAACCGCCCTGCACAAACAAACGGCGTCTCACAAGAACAAGTCTCTACCGCGACAGAC
AAAGCTGCGAATCCAGATGAGTGGGGGGAGTTTCTCCATATACCTGGCCAAAAATATCACGACTTTACCAAGATA
CGAGAAGAGATTGCCCGCGAGACGGAAGCCAAGGTTGGCAAGAATGCTGGAATATCGCCTGCCCCTATAAACCTG
CGCATTTACTCGCCTAATGTTCTGACCCTTACGCTCGTTGATCTTCCCGGCCTGACCAAGGTGCCGGTGGGCGAT
CAACCGCGCGACATCGAACGGCAAATCCGAGAAATGGTGCTCAAGTACATTGGCAAGTCCAATGCCATTATTCTC
GCCGTGACGGCGGCCAATATCGATCTAGCCAACTCGGATGGCTTGAAGCTGGCGCGCGAGGTCGACCCTGAAGGC
CAAAGAACCATTGGTGTCTTGACAAAGGTGGACCTGATGGACGAAGGAACCGACGTTATCGACATTTTATCTAAC
CGTGTGATTCCACTGCGGCTGGGATACGTGCCTGTAGTCAATAGAGGACAGCGTGATATTGACAACAAAAAGGCA
ATCAATGTGGCTCTGGATGCAGAAAAGGCTTTCTTCGAGAACCACAAGGCCTACCGCAACAAGAGCTCCTACTGT
GGCACGCCTTATCTAGCCCGCAAGCTCAACCTTATCCTCATGATGCACATCAAACAGACACTGCCTGATATCAAG
GCAAGGATTGCTAGCTCGCTGCAAAAGTATTCGAGTGAGCTTGAGTCTCTGGGCCCGTCGATGCTGGGCAACAGT
GCCAACATTGTCCTCAACATCATCACCGAATTTATCAATGAGTGGCGCACTGTACTCGACGGAAACAACACGGAG
CTATCCAGTACAGAGCTGTCTGGCGGTGCACGCATCAGCTTCGTCTTCCACGAGCTTTACGCCAATGGCGTCAAG
GCTCTGGATCCTTTTGACGTAGTCAAGGATGTCGACATTCGCACCATATTGTATAACTCATCAGGCTCCTCCCCT
GCTCTTTTTGTTGGCACAACAGCCTTTGAACTCATTGTCAAGCAGCAAATCAAACGCATGGAAGATCCCAGTCTC
AAGTGCGTGTCGCTGGTATACGATGAGCTGGTGCGCATACTGTCACAACTTCTGGGCAAGCAGCTGTACCGCCGC
TACCCTTCACTCAAAGAAAAGATGCATGGTGTTGTGATATCCTTTTTCAAAAAGGCCATGGAGCCCACCAATAAG
CTGGTCCGTGATCTTGTTTCTATGGAGGCTTGCTACATCAACACGGGCCATCCAGACTTTCTCAATGGGCATCGA
GCCATGGCCATTGTGAACGAGCGGTATAACCCCTCAAAGCCAGTGCAGGTGGATCCCAAAACAGGCAAGCCACTG
GCGCAGTCATCGACGCCCGCTAGAGCTGCTAGCCCTACAGTTCCTGTCAACGACATGGATGGAAATAATTCTGGC
TTCTTTGGCAGCTTCTTCGCCGCCAAGAACAAGAAAAAGGCGGCCGCTATGGATGCGCCGCCTCCGACCCTCAAG
GCCTCGGGAACATTGTCTGAGCGCGAAAACATTGAGGTGGAGGTCATCAAGCTTCTTATTTCGTCATACTACAAC
ATTACTAAACGCACAATGATTGACATGGTGCCCAAGGCCATCATGCTGACTCTTGTCCAATTTACCAAGGACGAG
ATGCAGCGCGAGTTACTGGAAAACATGTATAGGACAGACCAGTTGGACGACTTGCTGAAGGAGAGTGACTTTACC
ATTCGCAGACGGAAAGAGTGCCAGCAGATGGTCGAGTCGCTATCCAAGGCAAGCGAGATTGTCAGCCAGGTTCAG
TAA
Gene >OphauG2|3488
ATGAGCAACACCCTCGCGACGCCGGGTGGCATCTCGGATCCAGCCTTGATCCAGTGAGTCTTGTATTCCCAAGCA
CGTGGCCAAACCTTGAACATCTCTGACGAAGCCCTTGGCAGACTCGTCAACAAGCTCCAAGATGTCTTTGCGACA
GTTGGCGTCAATAATCCCATCGATCTCCCTCAAATTGCTGTTGTGGGTAGTCAGTCGAGTGGAAAGAGCTCAGTA
CTGGAAAACATTGTCGGGCGTGACTTGTAAGTAAAGCGAGGCCTCTTGGGCTGTATAGAATTCCCGCTGACGCAA
CCCCTTTTCCGTCCAGCTTGCCTCGAGGCGCCGGCATCTGTACTCGTCGCCCCCTTGTCCTTCAACTCATCAACC
GCCCTGCACAAACAAACGGCGTCTCACAAGAACAAGTCTCTACCGCGACAGACAAAGCTGCGAATCCAGATGAGT
GGGGGGAGTTTCTCCATATACCTGGCCAAAAATATCACGACTTTACCAAGATACGAGAAGAGATTGCCCGCGAGA
CGGAAGCCAAGGTTGGCAAGAATGCTGGAATATCGCCTGCCCCTATAAACCTGCGCATTTACTCGCCTAATGTTC
TGACCCTTACGCTCGTTGATCTTCCCGGCCTGACCAAGGTGCCGGTGGGCGATCAACCGCGCGACATCGAACGGC
AAATCCGAGAAATGGTGCTCAAGTACATTGGCAAGTCCAATGCCATTATTCTCGCCGTGACGGCGGCCAATATCG
ATCTAGCCAACTCGGATGGCTTGAAGCTGGCGCGCGAGGTCGACCCTGAAGGCCAAAGAACCATTGGTGTCTTGA
CAAAGGTGGACCTGATGGACGAAGGAACCGACGTTATCGACATTTTATCTAACCGTGTGATTCCACTGCGGCTGG
GATACGTGCCTGTAGTCAATAGAGGACAGCGTGATATTGACAACAAAAAGGCAATCAATGTGGCTCTGGATGCAG
AAAAGGCTTTCTTCGAGAACCACAAGGCCTACCGCAACAAGAGCTCCTACTGTGGCACGCCTTATCTAGCCCGCA
AGCTCAACCTTATCCTCATGATGCACATCAAACAGACACTGCCTGATATCAAGGCAAGGATTGCTAGCTCGCTGC
AAAAGTATTCGAGTGAGCTTGAGTCTCTGGGCCCGTCGATGCTGGGCAACAGTGCCAACATTGTCCTCAACATCA
TCACCGAATTTATCAATGAGTGGCGCACTGTACTCGACGGAAACAACACGGAGCTATCCAGTACAGAGCTGTCTG
GCGGTGCACGCATCAGCTTCGTCTTCCACGAGCTTTACGCCAATGGCGTCAAGGCTCTGGATCCTTTTGACGTAG
TCAAGGATGTCGACATTCGCACCATATTGTATAACTCATCAGGCTCCTCCCCTGCTCTTTTTGTTGGCACAACAG
CCTTTGAACTCATTGTCAAGCAGCAAATCAAACGCATGGAAGATCCCAGTCTCAAGTGCGTGTCGCTGGTATACG
ATGAGCTGGTGCGCATACTGTCACAACTTCTGGGCAAGCAGCTGTACCGCCGCTACCCTTCACTCAAAGAAAAGA
TGCATGGTGTTGTGATATCCTTTTTCAAAAAGGCCATGGAGCCCACCAATAAGCTGGTCCGTGATCTTGTTTCTA
TGGAGGCTTGCTACATCAACACGGGCCATCCAGACTTTCTCAATGGGCATCGAGTATGCATCATATCTCTTGGCT
CTGCTTTTCATTATCGGTCTTGTCGCTAACATTGACTACAGGCCATGGCCATTGTGAACGAGCGGTATAACCCCT
CAAAGCCAGTGCAGGTGGATCCCAAAACAGGCAAGCCACTGGCGCAGTCATCGACGCCCGCTAGAGCTGCTAGCC
CTACAGTTCCTGTCAACGACATGGATGGAAATAATTCTGGCTTCTTTGGCAGCTTCTTCGCCGCCAAGAACAAGA
AAAAGGCGGCCGCTATGGATGCGCCGCCTCCGACCCTCAAGGCCTCGGGAACATTGTCTGAGCGCGAAAACATTG
AGGTGGAGGTCATCAGTGAGTTTGGCGTGTCAAGCTGGTAGCTCATCAGAAGCTGACGAGGGCATGACAGAGCTT
CTTATTTCGTCATACTACAACATTACTAAACGCACAATGATTGACATGGTGCCCAAGGCCATCATGCTGACTCTT
GTCCAGTATGTGCCGGAAAGATGGAAGTAAAGATGAAGACGGGGCTAACAAGATGGGACAGATTTACCAAGGACG
AGATGCAGCGCGAGTTACTGGAAAACATGTATAGGACAGACCAGTTGGACGACTTGCTGAAGGAGAGTGACTTTA
CCATTCGCAGACGGAAAGAGTGCCAGCAGATGGTCGAGTCGCTATCCAAGGCAAGCGAGATTGTCAGCCAGGTTC
AGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail