Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3483
Gene name
LocationContig_265:14991..16059
Strand-
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain 9.6E-25 186 313

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE3|YNZ6_SCHPO Putative lysine N-acyltransferase C17G9.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.06c PE=3 SV=1 152 349 5.0E-29
sp|Q47317|IUCB_ECOLX N(6)-hydroxylysine O-acetyltransferase OS=Escherichia coli GN=iucB PE=1 SV=1 150 352 3.0E-15
sp|Q9Z3Q9|RHBD_RHIME Rhizobactin siderophore biosynthesis protein RhbD OS=Rhizobium meliloti (strain 1021) GN=rhbD PE=3 SV=1 160 351 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3483
MVNEDRAEFGPVLELRILGLADMDPRSALAAGGNDGHLVVAWASVYALWLHPHLRDQDVIAISVDNQRVSEYMRC
TGLAVASPFSPLTGPDAICWLQREAFWQGAGAPDSQHWLQSRPEVTSFPGFNQTLGVFPSQLGFTHKGNVCTVHP
VRPCKPKPGSVIYSRFIVDVGQQLTIMHIDASNALHFDAYRRWQNSERVNASWQERGSDEHHRQYLAAQLADAHT
MACLFAWDGELAGYTELGWVKEDEAACFFSSNCNVVVGEHDQNSHLLVGEEHLRGGARYQAVATSIKHCCFLRDP
RTRQILAEPRFDLAHVQIQNRFLPQEKKRRVHLPHKTAILFALQRDRFFQEAHFV*
Coding >OphauG2|3483
ATGGTCAATGAGGATAGAGCCGAGTTTGGCCCAGTCCTTGAGCTTCGGATTCTAGGCTTGGCTGACATGGACCCT
CGTTCTGCGTTGGCGGCTGGCGGCAACGATGGGCACCTTGTTGTGGCATGGGCCTCGGTTTACGCCTTATGGCTC
CATCCTCATCTCAGAGACCAAGATGTCATTGCCATTTCAGTCGACAACCAAAGAGTGAGCGAGTACATGCGATGC
ACCGGCTTAGCAGTAGCATCTCCATTCTCGCCGCTAACAGGCCCCGATGCCATCTGCTGGCTCCAGCGCGAGGCC
TTCTGGCAAGGAGCAGGTGCACCAGACTCGCAGCACTGGCTCCAGTCGCGGCCCGAGGTGACGAGCTTCCCCGGC
TTCAACCAAACACTAGGCGTCTTCCCCAGCCAGCTGGGCTTCACACACAAGGGCAACGTGTGCACGGTGCATCCC
GTGAGGCCGTGCAAGCCCAAGCCGGGCAGCGTCATCTACTCGCGCTTCATTGTCGATGTCGGGCAGCAGTTGACC
ATTATGCACATTGACGCCAGCAACGCGCTCCATTTCGACGCCTACAGACGCTGGCAGAACTCGGAGCGCGTCAAC
GCCTCGTGGCAAGAGCGCGGATCCGACGAGCACCACCGTCAATACCTGGCAGCCCAGCTGGCCGACGCACACACC
ATGGCGTGCCTGTTTGCATGGGACGGCGAGCTGGCTGGCTACACCGAGCTGGGGTGGGTCAAGGAGGACGAGGCG
GCCTGCTTCTTCAGCTCCAACTGCAATGTCGTTGTCGGCGAACACGACCAGAACTCGCATCTCTTGGTGGGCGAG
GAGCACCTGCGCGGCGGCGCCAGATATCAGGCTGTGGCCACGTCAATCAAGCACTGCTGCTTCCTGCGCGACCCT
CGCACCAGGCAGATCCTGGCTGAGCCTCGCTTCGATCTGGCCCATGTCCAAATCCAGAACAGGTTTCTGCCCCAG
GAGAAGAAGCGCCGTGTCCATCTGCCGCACAAGACGGCCATTCTCTTTGCCCTGCAGCGGGATCGCTTCTTCCAA
GAGGCCCATTTTGTTTGA
Transcript >OphauG2|3483
ATGGTCAATGAGGATAGAGCCGAGTTTGGCCCAGTCCTTGAGCTTCGGATTCTAGGCTTGGCTGACATGGACCCT
CGTTCTGCGTTGGCGGCTGGCGGCAACGATGGGCACCTTGTTGTGGCATGGGCCTCGGTTTACGCCTTATGGCTC
CATCCTCATCTCAGAGACCAAGATGTCATTGCCATTTCAGTCGACAACCAAAGAGTGAGCGAGTACATGCGATGC
ACCGGCTTAGCAGTAGCATCTCCATTCTCGCCGCTAACAGGCCCCGATGCCATCTGCTGGCTCCAGCGCGAGGCC
TTCTGGCAAGGAGCAGGTGCACCAGACTCGCAGCACTGGCTCCAGTCGCGGCCCGAGGTGACGAGCTTCCCCGGC
TTCAACCAAACACTAGGCGTCTTCCCCAGCCAGCTGGGCTTCACACACAAGGGCAACGTGTGCACGGTGCATCCC
GTGAGGCCGTGCAAGCCCAAGCCGGGCAGCGTCATCTACTCGCGCTTCATTGTCGATGTCGGGCAGCAGTTGACC
ATTATGCACATTGACGCCAGCAACGCGCTCCATTTCGACGCCTACAGACGCTGGCAGAACTCGGAGCGCGTCAAC
GCCTCGTGGCAAGAGCGCGGATCCGACGAGCACCACCGTCAATACCTGGCAGCCCAGCTGGCCGACGCACACACC
ATGGCGTGCCTGTTTGCATGGGACGGCGAGCTGGCTGGCTACACCGAGCTGGGGTGGGTCAAGGAGGACGAGGCG
GCCTGCTTCTTCAGCTCCAACTGCAATGTCGTTGTCGGCGAACACGACCAGAACTCGCATCTCTTGGTGGGCGAG
GAGCACCTGCGCGGCGGCGCCAGATATCAGGCTGTGGCCACGTCAATCAAGCACTGCTGCTTCCTGCGCGACCCT
CGCACCAGGCAGATCCTGGCTGAGCCTCGCTTCGATCTGGCCCATGTCCAAATCCAGAACAGGTTTCTGCCCCAG
GAGAAGAAGCGCCGTGTCCATCTGCCGCACAAGACGGCCATTCTCTTTGCCCTGCAGCGGGATCGCTTCTTCCAA
GAGGCCCATTTTGTTTGA
Gene >OphauG2|3483
ATGGTCAATGAGGATAGAGCCGAGTTTGGCCCAGTCCTTGAGCTTCGGATTCTAGGCTTGGCTGACATGGACCCT
CGTTCTGCGTTGGCGGCTGGCGGCAACGATGGGCACCTTGTTGTGGCATGGGCCTCGGTTTACGCCTTATGGCTC
CATCCTCATCTCAGAGACCAAGATGTCATTGCCATTTCAGTCGACAACCAAAGAGTGAGCGAGTACATGCGATGC
ACCGGCTTAGCAGTAGCATCTCCATTCTCGCCGCTAACAGGCCCCGATGCCATCTGCTGGCTCCAGCGCGAGGCC
TTCTGGCAAGGAGCAGGTGCACCAGACTCGCAGCACTGGCTCCAGTCGCGGCCCGAGGTGACGAGCTTCCCCGGC
TTCAACCAAACACTAGGCGTCTTCCCCAGCCAGCTGGGCTTCACACACAAGGGCAACGTGTGCACGGTGCATCCC
GTGAGGCCGTGCAAGCCCAAGCCGGGCAGCGTCATCTACTCGCGCTTCATTGTCGATGTCGGGCAGCAGTTGACC
ATTATGCACATTGACGCCAGCAACGCGCTCCATTTCGACGCCTACAGACGCTGGCAGAACTCGGAGCGCGTCAAC
GCCTCGTGGCAAGAGCGCGGATCCGACGAGCACCACCGTCAATACCTGGCAGCCCAGCTGGCCGACGCACACACC
ATGGCGTGCCTGTTTGCATGGGACGGCGAGCTGGCTGGCTACACCGAGCTGGGGTGGGTCAAGGAGGACGAGGCG
GCCTGCTTCTTCAGCTCCAACTGCAATGTCGTTGTCGGCGAACACGACCAGAACTCGCATCTCTTGGTGGGCGAG
GAGCACCTGCGCGGCGGCGCCAGATATCAGGCTGTGGCCACGTCAATCAAGCACTGCTGCTTCCTGCGCGACCCT
CGCACCAGGCAGATCCTGGCTGAGCCTCGCTTCGATCTGGCCCATGTCCAAATCCAGAACAGGTTTCTGCCCCAG
GAGAAGAAGCGCCGTGTCCATCTGCCGCACAAGACGGCCATTCTCTTTGCCCTGCAGCGGGATCGCTTCTTCCAA
GAGGCCCATTTTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail