Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3482
Gene name
LocationContig_265:76..14227
Strand-
Gene length (bp)14151
Transcript length (bp)14046
Coding sequence length (bp)14046
Protein length (aa) 4682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.4E-59 215 631
PF00501 AMP-binding AMP-binding enzyme 3.2E-63 1333 1754
PF00501 AMP-binding AMP-binding enzyme 1.3E-64 2482 2886
PF00668 Condensation Condensation domain 1.7E-13 889 1196
PF00668 Condensation Condensation domain 6.0E-12 1984 2302
PF00668 Condensation Condensation domain 1.0E-10 3787 4012
PF00668 Condensation Condensation domain 9.4E-09 4262 4510
PF00550 PP-binding Phosphopantetheine attachment site 3.0E-07 1883 1948
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-05 4121 4185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 144 4637 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 211 3641 4.0E-169
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 205 3078 4.0E-153
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 206 3040 2.0E-145
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 206 3085 1.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 144 4637 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 211 3641 4.0E-169
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 205 3078 4.0E-153
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 206 3040 2.0E-145
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 206 3085 1.0E-143
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 211 3091 1.0E-142
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 211 3580 9.0E-126
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 215 3003 5.0E-124
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 204 3075 1.0E-122
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 211 3295 2.0E-122
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 206 3345 3.0E-120
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1008 3107 2.0E-107
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 241 3154 2.0E-106
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 241 3154 3.0E-106
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1360 3293 6.0E-103
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1008 3099 7.0E-103
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1323 3297 2.0E-102
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 274 1946 8.0E-100
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1118 3126 1.0E-99
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 206 1930 2.0E-99
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 206 1853 3.0E-99
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1002 3118 8.0E-99
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1002 3071 4.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 147 1913 2.0E-97
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 905 3297 1.0E-96
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 905 3297 2.0E-96
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1118 3297 5.0E-96
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 892 2996 6.0E-96
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1007 2996 3.0E-95
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 65 2349 3.0E-94
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 869 3118 2.0E-93
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 893 3119 9.0E-93
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 204 2306 5.0E-92
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1835 3947 1.0E-91
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1333 3075 3.0E-91
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1333 3078 1.0E-90
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 179 2168 8.0E-89
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 206 2154 1.0E-88
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1308 3078 7.0E-88
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1119 3096 6.0E-87
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 206 2158 1.0E-86
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 105 2162 1.0E-86
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1329 3126 4.0E-84
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1359 3076 9.0E-84
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 211 2159 1.0E-83
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 147 2296 8.0E-83
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1008 2994 9.0E-83
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 206 1936 1.0E-78
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1356 2994 1.0E-78
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1346 3294 2.0E-77
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1329 3225 2.0E-76
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1321 2994 3.0E-76
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 241 1913 4.0E-76
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 215 1944 5.0E-76
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1329 3225 5.0E-76
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1333 3294 1.0E-75
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1329 2994 1.0E-75
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1349 3108 1.0E-75
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 239 2196 3.0E-75
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1351 3419 6.0E-75
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 776 1924 5.0E-68
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1357 3008 2.0E-66
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 868 2155 1.0E-58
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 971 2297 1.0E-58
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1007 2296 2.0E-58
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1984 3422 8.0E-57
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 846 2043 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 869 1864 4.0E-55
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 892 1951 5.0E-55
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 215 1951 8.0E-55
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 211 729 9.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1983 2994 4.0E-54
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 206 801 8.0E-54
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 939 1955 2.0E-53
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 211 1185 4.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1983 2994 5.0E-53
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 124 841 1.0E-52
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1329 2429 3.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1329 1951 8.0E-51
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1248 1924 3.0E-50
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2487 3297 3.0E-50
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1326 1930 4.0E-50
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1360 2897 9.0E-50
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1326 1930 1.0E-49
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 980 1948 1.0E-49
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 211 726 1.0E-49
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 211 801 1.0E-49
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 939 1924 2.0E-49
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1360 2154 6.0E-49
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2489 3432 7.0E-49
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 203 1290 9.0E-49
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1333 2998 3.0E-48
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 980 1919 4.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1008 2042 8.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1966 3078 8.0E-48
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1326 2041 1.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1333 2159 2.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 206 1069 2.0E-47
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 215 1147 2.0E-47
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1329 1937 2.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 155 723 5.0E-47
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1984 3420 8.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 215 726 9.0E-47
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 981 2161 2.0E-46
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2019 3296 3.0E-46
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1326 2299 4.0E-46
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1134 1924 7.0E-46
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 206 803 1.0E-45
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1966 2994 1.0E-45
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 206 1132 2.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1983 3338 2.0E-45
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 206 723 2.0E-45
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 211 723 2.0E-45
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 204 726 3.0E-45
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 893 1954 3.0E-45
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 206 765 4.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1483 3016 4.0E-45
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1878 3294 5.0E-45
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1986 2994 8.0E-45
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 196 726 9.0E-45
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 206 723 1.0E-44
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1007 1949 1.0E-44
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 147 726 2.0E-44
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 985 1937 2.0E-44
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 243 1182 2.0E-44
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 150 726 3.0E-44
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1329 1946 5.0E-44
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2485 3073 7.0E-44
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2134 3073 1.0E-43
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 206 722 2.0E-43
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 211 723 2.0E-43
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1003 1853 4.0E-43
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 215 722 4.0E-43
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2473 3101 5.0E-43
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 973 2154 5.0E-43
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 184 745 6.0E-43
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 210 723 8.0E-43
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 361 1937 9.0E-43
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 210 723 3.0E-42
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2017 3297 3.0E-42
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 215 723 4.0E-42
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1255 1853 4.0E-42
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1988 3076 5.0E-42
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 211 1205 7.0E-42
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1113 1944 8.0E-42
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1007 1913 1.0E-41
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 211 1205 2.0E-41
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2097 3003 3.0E-41
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1009 1853 3.0E-41
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2379 2994 4.0E-41
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1307 2161 4.0E-41
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 211 803 6.0E-41
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2123 3294 8.0E-41
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 210 722 8.0E-41
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 206 723 9.0E-41
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1307 2161 9.0E-41
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 243 722 1.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1140 1853 1.0E-40
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 981 1944 2.0E-40
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2488 3420 2.0E-40
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 213 1177 2.0E-40
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1329 1853 2.0E-40
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1979 3294 3.0E-40
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 210 723 4.0E-40
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 184 723 6.0E-40
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2129 3297 7.0E-40
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1359 1853 7.0E-40
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 209 734 7.0E-40
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2485 3110 7.0E-40
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 206 722 9.0E-40
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 125 727 1.0E-39
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2476 3073 1.0E-39
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2476 3073 1.0E-39
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1329 1853 1.0E-39
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2120 2994 2.0E-39
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2480 3973 2.0E-39
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2399 3429 2.0E-39
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 206 722 2.0E-39
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 243 765 8.0E-39
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 211 723 1.0E-38
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2516 3470 2.0E-38
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 238 721 2.0E-38
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 242 723 3.0E-38
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 169 1042 4.0E-38
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2391 2918 7.0E-38
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1360 2293 1.0E-37
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1360 2293 2.0E-37
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 206 648 3.0E-37
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 243 723 4.0E-37
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1321 2159 6.0E-37
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 211 726 6.0E-37
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2376 3101 7.0E-37
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 179 723 2.0E-36
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1205 2215 3.0E-36
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2489 3085 3.0E-36
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 217 646 3.0E-36
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1205 2215 4.0E-36
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2005 3101 6.0E-36
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 217 646 6.0E-36
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1359 1860 7.0E-36
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2487 3091 1.0E-35
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 255 820 1.0E-35
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2097 3297 1.0E-35
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2488 3108 1.0E-35
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 217 646 1.0E-35
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1358 2219 2.0E-35
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 206 733 2.0E-35
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 215 733 2.0E-35
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1304 2296 2.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 219 723 2.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 219 723 2.0E-35
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 211 1037 3.0E-35
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1329 1767 3.0E-35
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 206 722 6.0E-35
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 211 1037 7.0E-35
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2487 3423 7.0E-35
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1360 1853 7.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1360 1853 7.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1360 1853 8.0E-35
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 215 795 1.0E-34
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 211 745 1.0E-34
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2473 2994 1.0E-34
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 241 722 2.0E-34
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 241 722 2.0E-34
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1359 1944 3.0E-34
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 195 1176 3.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 219 723 3.0E-34
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2468 3107 7.0E-34
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1329 1936 7.0E-34
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 241 722 9.0E-34
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 177 738 1.0E-33
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 177 738 1.0E-33
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 282 727 1.0E-33
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1360 1853 1.0E-33
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2488 3119 2.0E-33
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2487 3431 2.0E-33
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2486 3298 2.0E-33
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 206 723 3.0E-33
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 241 722 3.0E-33
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2488 2994 4.0E-33
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2487 3431 4.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 211 1176 6.0E-33
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1359 1856 6.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 282 1179 7.0E-33
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 210 723 7.0E-33
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2485 2994 8.0E-33
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 211 722 9.0E-33
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 211 722 9.0E-33
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 361 770 1.0E-32
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 361 770 1.0E-32
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2488 2996 1.0E-32
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1359 1855 1.0E-32
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2484 3421 2.0E-32
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1320 1924 3.0E-32
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2440 2996 4.0E-32
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 211 723 5.0E-32
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 242 770 5.0E-32
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 215 723 6.0E-32
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2435 3102 7.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 219 723 8.0E-32
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2517 3031 1.0E-31
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 241 725 1.0E-31
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 211 722 1.0E-31
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1333 1953 2.0E-31
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2272 3116 2.0E-31
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2272 3102 2.0E-31
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1329 1853 2.0E-31
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 211 722 2.0E-31
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 211 722 2.0E-31
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 211 722 2.0E-31
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 211 722 2.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1289 1853 2.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1289 1853 2.0E-31
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 211 722 2.0E-31
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1329 1853 2.0E-31
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2395 2994 3.0E-31
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 211 726 3.0E-31
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1329 1853 3.0E-31
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 211 722 3.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 216 722 3.0E-31
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1329 1853 4.0E-31
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2485 2994 5.0E-31
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1329 1853 5.0E-31
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1329 1853 5.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2508 3110 5.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2508 3110 5.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 219 726 5.0E-31
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 244 1069 7.0E-31
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 211 722 8.0E-31
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1359 2159 1.0E-30
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1329 1853 1.0E-30
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1359 1855 2.0E-30
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 194 722 2.0E-30
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2376 3076 2.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 219 726 2.0E-30
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1360 2299 2.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 219 726 2.0E-30
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2487 3305 3.0E-30
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1329 1853 3.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 219 726 3.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 221 722 4.0E-30
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 243 722 5.0E-30
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2486 3334 6.0E-30
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1327 1913 7.0E-30
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 198 720 8.0E-30
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 241 722 8.0E-30
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 150 818 1.0E-29
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 202 723 1.0E-29
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1334 1853 1.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 221 722 1.0E-29
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 202 723 2.0E-29
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 182 801 2.0E-29
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 208 655 3.0E-29
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2485 2997 3.0E-29
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 215 648 5.0E-29
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1329 1853 5.0E-29
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 186 735 5.0E-29
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 186 735 6.0E-29
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 186 735 6.0E-29
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 219 726 6.0E-29
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2488 3450 9.0E-29
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 243 722 9.0E-29
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2476 3154 1.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1349 1855 1.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 242 723 1.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 242 723 1.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 242 723 1.0E-28
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2476 3154 2.0E-28
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2458 2994 2.0E-28
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2458 2994 2.0E-28
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2458 2994 2.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1349 1853 2.0E-28
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2458 2994 3.0E-28
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2458 2994 4.0E-28
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2458 2994 4.0E-28
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2458 2994 5.0E-28
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2458 2994 5.0E-28
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2458 2994 5.0E-28
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2458 2994 5.0E-28
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1349 1853 5.0E-28
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2458 2994 6.0E-28
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 209 731 9.0E-28
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1319 1953 9.0E-28
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1984 2994 1.0E-27
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1319 1953 1.0E-27
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1319 1953 1.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1353 1853 1.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1353 1853 1.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1353 1853 1.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 282 797 2.0E-27
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2458 2994 3.0E-27
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2458 2994 3.0E-27
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 242 739 3.0E-27
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3585 4587 4.0E-27
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 210 795 4.0E-27
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2247 3094 5.0E-27
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1313 1944 5.0E-27
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 211 801 5.0E-27
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2458 2994 6.0E-27
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 223 722 6.0E-27
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2474 2998 1.0E-26
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2458 2994 1.0E-26
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 278 722 2.0E-26
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1349 1853 2.0E-26
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2458 2994 2.0E-26
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1349 1853 2.0E-26
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 243 722 2.0E-26
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1389 1853 5.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 213 723 5.0E-26
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1389 1853 6.0E-26
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1389 1853 6.0E-26
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1389 1853 6.0E-26
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1389 1853 6.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1360 1853 8.0E-26
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 213 722 9.0E-26
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 213 722 9.0E-26
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 213 722 9.0E-26
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 213 722 9.0E-26
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 213 722 9.0E-26
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 213 722 1.0E-25
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 213 722 1.0E-25
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 213 722 1.0E-25
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 213 722 1.0E-25
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1389 1853 1.0E-25
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1389 1853 1.0E-25
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1389 1853 1.0E-25
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1389 1853 1.0E-25
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1389 1853 1.0E-25
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1389 1853 1.0E-25
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 213 722 1.0E-25
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1302 1853 1.0E-25
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 273 738 1.0E-25
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1358 1856 2.0E-25
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1358 1856 2.0E-25
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 206 723 2.0E-25
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 243 722 2.0E-25
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 241 723 2.0E-25
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2489 3292 3.0E-25
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2486 2994 3.0E-25
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2487 2994 3.0E-25
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1349 1853 4.0E-25
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1358 1856 8.0E-25
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1358 1855 9.0E-25
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2471 2994 1.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1358 1856 1.0E-24
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 201 721 1.0E-24
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2430 3154 2.0E-24
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2488 3080 2.0E-24
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2471 2994 3.0E-24
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2528 2994 3.0E-24
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1247 1930 5.0E-24
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1359 1855 6.0E-24
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2471 2994 9.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1358 1856 9.0E-24
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1358 1856 1.0E-23
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1349 1855 1.0E-23
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1349 1853 1.0E-23
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1349 1853 1.0E-23
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2458 2994 2.0E-23
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1360 1853 2.0E-23
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1349 1853 2.0E-23
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2488 3078 3.0E-23
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2485 3332 3.0E-23
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2458 2994 3.0E-23
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2470 2997 4.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1349 1856 5.0E-23
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2486 2996 6.0E-23
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1359 1937 6.0E-23
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1349 1853 7.0E-23
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1349 1853 7.0E-23
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1349 1853 7.0E-23
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1349 1853 7.0E-23
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2458 2996 9.0E-23
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 241 720 1.0E-22
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 241 720 1.0E-22
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 241 720 1.0E-22
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 241 720 1.0E-22
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2488 3118 2.0E-22
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 241 720 2.0E-22
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 200 723 3.0E-22
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1359 1855 4.0E-22
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2458 2994 5.0E-22
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2485 3107 8.0E-22
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 241 720 8.0E-22
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 241 720 8.0E-22
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2485 3107 9.0E-22
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2485 3107 9.0E-22
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2467 2996 1.0E-21
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2489 3413 1.0E-21
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2458 2994 1.0E-21
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1360 1861 2.0E-21
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 120 655 2.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 860 1749 4.0E-21
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2482 2994 8.0E-21
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2482 2994 8.0E-21
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2482 2994 1.0E-20
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2517 2996 1.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1333 1773 2.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2489 2903 2.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1328 1820 3.0E-20
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2515 3097 4.0E-20
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 286 648 4.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2516 2997 7.0E-20
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2465 2994 8.0E-20
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2508 2994 2.0E-19
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2508 2994 2.0E-19
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2508 2994 2.0E-19
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2508 2994 2.0E-19
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2508 2994 2.0E-19
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2455 2997 3.0E-19
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2455 2997 3.0E-19
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2469 2902 3.0E-19
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2455 2997 4.0E-19
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 363 811 4.0E-19
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2466 2999 5.0E-19
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2489 2994 6.0E-19
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2489 2994 6.0E-19
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2489 2994 6.0E-19
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2489 2994 6.0E-19
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2489 2994 6.0E-19
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2489 2994 6.0E-19
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2489 2994 7.0E-19
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2489 2994 7.0E-19
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2489 2994 7.0E-19
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2489 2994 8.0E-19
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2466 2999 1.0E-18
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2508 2994 1.0E-18
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2508 2994 1.0E-18
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1250 1930 1.0E-18
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2481 2994 1.0E-18
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2477 2996 2.0E-18
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2455 2997 2.0E-18
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2489 2994 2.0E-18
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2345 2994 5.0E-18
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2485 3101 1.0E-17
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2374 2994 2.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2486 2997 3.0E-17
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1326 1938 9.0E-17
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 208 723 1.0E-16
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 211 1022 9.0E-16
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 214 723 1.0E-15
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2375 2994 1.0E-15
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 215 723 3.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2611 3009 8.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3638 4432 1.0E-14
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 211 723 2.0E-14
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 224 721 2.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 224 801 2.0E-14
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 217 721 2.0E-14
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1326 1764 2.0E-14
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 211 721 5.0E-14
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1371 1944 2.0E-13
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 236 722 2.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 224 847 5.0E-13
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2533 2916 6.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1984 2893 3.0E-12
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 1360 1854 3.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 211 624 6.0E-12
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1345 1857 1.0E-11
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 2460 2998 1.0E-11
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4139 4557 4.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 214 721 4.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 217 721 4.0E-11
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 217 722 5.0E-11
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 2464 2946 7.0E-11
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 2486 2919 7.0E-11
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1986 2388 4.0E-10
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1485 1857 4.0E-10
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2465 2996 6.0E-10
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2615 3016 7.0E-10
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 2488 2924 7.0E-10
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 237 722 1.0E-09
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2487 2936 1.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 215 721 2.0E-09
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 2480 3003 2.0E-09
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 2460 2999 2.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 215 721 2.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2510 2914 4.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 215 721 4.0E-09
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 2616 3000 4.0E-09
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 2616 3000 4.0E-09
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 2616 3000 4.0E-09
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 2616 3000 4.0E-09
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 2480 3003 4.0E-09
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 2480 3003 5.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2616 3000 5.0E-09
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 2460 2946 5.0E-09
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 2464 2938 6.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 2616 3000 6.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 2616 3000 6.0E-09
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 2480 2967 8.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 2616 3000 8.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 2616 3000 8.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2511 2888 9.0E-09
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 2460 2997 1.0E-08
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 361 722 1.0E-08
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 361 722 1.0E-08
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 236 721 2.0E-08
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2818 2994 5.0E-08
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2615 3039 8.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2465 2878 9.0E-08
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 1329 1856 9.0E-08
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 236 721 1.0E-07
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 2460 2943 1.0E-07
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 215 643 2.0E-07
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 215 643 2.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 365 721 2.0E-07
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2616 2994 3.0E-07
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2616 2994 3.0E-07
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2616 2994 3.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 2460 2940 5.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2616 3009 5.0E-07
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2616 2960 5.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4133 4527 6.0E-07
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2616 2960 6.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2507 2899 6.0E-07
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 4103 4579 7.0E-07
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2616 3009 7.0E-07
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2616 3009 7.0E-07
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2616 3009 7.0E-07
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2465 2878 8.0E-07
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2616 3000 8.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2616 3000 9.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1366 1856 1.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2616 3000 1.0E-06
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2616 3009 1.0E-06
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2468 2878 1.0E-06
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2616 3009 1.0E-06
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1357 1855 2.0E-06
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 1368 1863 2.0E-06
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2616 3009 2.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3129 3514 3.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4068 4527 3.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2466 2899 3.0E-06
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 2525 2944 3.0E-06
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 243 722 3.0E-06
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 2555 2940 5.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1343 1766 6.0E-06
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 215 722 8.0E-06
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2468 3001 8.0E-06
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 236 565 8.0E-06
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 2525 2944 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3482
MQTSMSQLPVTRLGPMHCRQQQSSYELETPISRVQDDAQLLRWQCCFDCHESKPDKDTCVEAFVKLVSHLVILQV
GEAYCIQDSRRRGFILAHHIDDEHQAPTFIKCQDGQDIPSDFSIGKGKALQLHVDDVSGQVWLEALPNLVPEAAL
EALGHMLQDLIASLQQSQEKQCQREWTQSSLLNIPPAARPLVLFPYESVCSGRLDPEPALLHRQFEQRAAETPER
TALDFLVDLENGNRMQYTYQQVDNAANALAAELAQLCAQSGIKTAAVLIGPSPELYVSYLAVLKAGMAFCPVPMD
VPEARKKVLMADLKPAVLLVATSVHSRPCEFRTPTVTIDVTGHLVSCNTKSKTCSLAAETDVAYILYTSGSSGMP
KGVEISHIAASCTISALSAHCGFLAQADSALRPIRWFQGAAPTFDISLFEIFWTLSTGSTLCCAPREFILQDMNK
VVGHLNADITNITPSFASLLDPSLLRGLMVGGETLNTRLVRDFACHTSSRGHSQDRLGGIYNGYGPTETAIYCIA
QSHVPVEQRGSVLGKPLATSGIMIVAERARTLQPVPMGAIGELVVTGPQVSSTGYLNRPDETARVFIDDAQWGRA
YRTGDRARIVWNDAGEPVVEFLGRISDGQVKLRGRRVELGEVDKVLASRVQGIREILSCVWTLDRIVTLVVLEPR
DGIVDFGLVRQRCLETAQRHLPDYMRPFRILQVEALPKSSSGKIDRRAASAYAQQTVGKSLEPLPTVEPLTNPQD
AKMEQELVCILSEMLQYSCKPAHATLTAATALDEAGLDSLGAMRLLRDIRQKWPACQDTRLNPPMALLLKSGASI
RSVFFPLVQDMDKEAETRRQLAQLSSRHMSEALNKLNLSNEADIDLILPTTCTQSQLAVSFAINPQSYVSHSVLR
IKPGVSAQALTKAVETVVYQQAIYRCAILAVQTSLSPFIQVVLAPEAWQRLNEKTSRIVHRRARRALVSNEAQEW
LDVAEKNMSLDSQRLYHIQIVESDSASDSTSLLVISVAHCICDGASIEVLMSDIARQMAGLEPLPRHGIYNVVLE
WASNIEAKTDELWQGSLKGWEAQSLGSLSGNKATSHSTHGHAMVQYASGLTWQALQDKSIALGASPLTVLQASWA
LLLHYFSETDTEQVVFGSVISGHNVPSHAPAFSVLPCRIALPANQTVRQLLDGLTRASRFTQSRRHTSFGLFKTL
PYTTALALQVYPQLSPEDAIPVPWTEIQRPAMRYDLAMFVEIFPQGLDSLGHQQESNQMTFKLTYHQYALSELAA
TCIVKQLDALTEAILASHAQDMTQGLPAHIPQRLLSVQGTRTAARDKKQASQLLHAQFEEQAVSTPHLLALSFYP
SLDSPRVDVSYAELDARANSLAETLREEDAEIIPICMHRSVELYVAVLAILKAGSAWCPIDETSPLQRRTSLIAR
TQSKVLVTSTDSLPLVEPCLADKSLDGVRMVLVDQHAHDKTHAKPEARPGVLSLEYLSGKHLAYLLWTSGTTGEP
KGVMMQHSAAAQAMRDLQSRVEHCSEAGQVRTLQLSAYSFDVFVQDVFYTWGVAGSVVSGPTELVLGSFVDFVWK
SCPTHAHLTPSFGASITVNDIKGSTLQHVTFIGEKLTEDVAEAWAAPGIASHTYNTYGPAENAVVSTMRRFYAKG
QDQAKAANVGFPLSQCTSYVVREIRAAQGKQDRWQLVPRYGVGELALGGAQMAKGYFGDAAKTAKAFIEGAGAIQ
ERIYLTGDLVRLNDNGVEFLGRNDDLVKITGIRIELSEISAACAEIKKQGAAIEHVETLHLERPGSGNKVIVVFV
SVKQDCLDTVELRSKVFQKARDLLPQYMVPGHVVILNTTMPRTASNKVNRKALEEVYRASDLKALAAEHGSKQQQ
SWTEQQLQVVQVMANVGQVAVESLSPQDSLAGLGLNSLGVTKLAWTLRQHLECHVGVMDLLRCQVTGELVDLVLS
KLAPPEEASWLTRIKDALTKGLHGSMRPADTLSVLPATPTQESLIVETMMEPRAYWAHLVFDMSHLGAVDCHGLK
EAWTAAADKFDILRTIFVPLAQLTVNNGDHGCIKWARQQGIHSTILQLVRKEPRVCWTWLSSHGHANQDDDLSQW
AQKLQMKLAPTATVEPPWAVTYSERQGKLMLSMHHALYDGVSGDMLMDTVAKLYQKQALVQDEAMMQFERGMGLG
LLPIASQRKEAASLWKKYLDKIRETTGPLNAVLPDLTQSRQEQPRRTLVATRLLPSSLVKVPPSTSFPPLPTLLQ
SAFGCILASYLELKAVVIGHNVSLRLLHSGLSRVMGPAMATVPLVIRADSGSAEELWTMMACESSTLLHSLHNLH
PIDISKLINDGRHGKNIPFPGLFVYHPASDSKHGAQDIFRQVGAALTFHVEHPLALNVFEAQATIELTGNASCIS
QTQLELMLDQIIHQARAMTQSPRSRLDQIQNTMDRRLMSISGQDTTLLCMPKHVDPTERVSVHALENPEWIAAEQ
VVCHDAEMVSKTITYTQLEKLTNIMVSRLASHEAGLESDDIVAMYMGRDIKSLAVTLAIFRAGYVYLAVDEQLPK
ARKQAMIGDSKAKLIVTTEQLSKDLDLSLESDAWVLMLPDGENDIDVMLSWPTSPLDGEMGLGGYLIYTSGSTGR
PKGVRVSNANLCHFIAAISTRITEASPVSARLGGTGKYLNLTSRAFDPHLTQIFVPWNLGYRVVIGNNWTAMLGN
LQQVINQLGITHFGSVPSVLTRLRLRPQEVSSVKVVTTGGEKASTELLDMWTSETESGGDDKATLINFYGPTEVT
IGCLGQAVDRHSTPRSLGKPLGDLEALLLCPNTGMEQVVARRGQVGELCMLGPQVALGYLNRPMEQDKSFQTTSL
LGHGVRRMYRTGDMMRMMHDGTLEFLGRADQQAKIRGQRLELDEIVSFLKQSASHEGQVEFAAVVLNNEGVLGFA
ARRTAALVREEIEAEAELVQKPGRAISRLLERLEQKCEAGLPAFMVPTMVWVSRIPYLAASGKVDTKSLTKLAHE
FAACQQNEERPDAQQDAAPGHDDLKTTEKVVAAAIDEVLGGQGCTSGIQTRPQSSLHGLGIDSLSALHVVSLLRK
RGFPHLTMADTMSSSSTVASIARLADGMASRAPQQPSTRTMPVLGRAHLGPAGAGLANIAIEAVVPCLPLQSALV
AQSLLWVSANSRRVEGRNGDSTALDVPYVTQFSYRLPRGSQVARWIKAAEQLVASEAMLRSCFVQNGQMLQVVLQ
WSSRLSPFEGEQDTAAMVAQMSVRPPIRIQVREDQDSGEIVMSFKMHHALFDRVAIDVLRKRLEQSYEGRRVVGG
RSLELLESISSYCHALGGQMEATARREWETRLAKMYPCRVGGNGNGNNKTTKSMARWSQCLSYSAQDLATALCLA
HTTRQASIVYGFVTSLRPLLSHVIGDIDDFIGPCLNTVVHTLSLDRGDETLSSLAHRVGEAHAAVCQGAMPLVSV
EKVQRWAGCQGKLWDSLLSINLVTPQEPMEKGKSPPCPSVESSSDMALAIDVDVHTNGRIVLNLSSGGALDQPQL
DRLGRLFERIVESCADDDTARVSHFVSLPSDVGSKAIIIARDAQDAFPQDEPFQEAMACVQAALCRLLDVKACDV
AGKTWLYQIGLDSISVFPLVSLIKQTSNVQLNADAVLKARSVMGVARLVRQAKRALDKRVLDKRALESDRTRGNP
RDKTSDKTVQQLATQVMFVATPLQAGMLSASLAIADKAYTYTHRVQLSAHALAADTAGLDCLVAAVRDTVQACEI
LRTHFIFTAHDEAPWIGIVSRSQQSHLVSWETLPSGRLSLTMHHALYDASSLEAMWEMLHQYYSQHLHGHGRGHG
AATEHLFRPFAAMVSAAQEDSVAFWSSLLRDYSYTPLAFPHDSLQTSWAFHMTLGQDDLSLVQARCTSLGVTIKV
AFELAWVKVLCQSLYRQADVVYGQVVSTAGACKQAVLGPTINTVPMRFSLVDKDSSKVLSVAEALVRLQRLNDDA
RGTTAMASLSRIQTLWRKSSQDQRRLPATLFQSLFVFDAVAAPLAPRCLFTPVDHETQATYDDYPLIVSFHMRGK
ILGVRLRAKTTSNPSHRVETVGKELDKTVKWLCQCKLDDDVAAMADLDLDSSSTTPPDLDLSSAVAKTANAILAL
AKTVLGTKICAKHIGLATPLVNMGLDSILAIRLSRLLKEQLGINASVFQLTKGASIHDLVKPMAPTDLANSETPT
RSLVTVGDELKPHISKLLRLQDDAMASILPVLAGQRAHLEQWLHSGKRFLEAPWVYRVETPPLGAATVARCWTEL
RRLHPILRTTFVCTGADMALVQVTLSEQWAAQGRRGLAHVHDASKPIQALIQDHLVETNAVPSDLMEPPARLSLL
EGLGGEALVLRLHHALYDAWTMAMIEDDLDRLLASTELCHDTTRHTTPDTAGSLRQVVCQIRDMRQRDAEESFWK
QYLSGAQDTVLSMASQSSNACLSTTRDSSPLGPRFKTTYSAAAASSSVSNASLSAAIIVAYASTLRRFTTASRPT
FGFSHASRALSSPDGTSTLDLTAARVPTLTLTPMCVDVCRPEKHQVASVQHHLAQLTKFAQSDRVRQFCPCFNTY
VNIVFARDSVEHPSPKVLRRHRLSEPLASDYWTVAKPWPDSDSTIQGLDTQHLCPHQFFFTVVVCPSRHVKVTVS
GDGSGLAMVTQLVSYFGSELERILDDDALLE*
Coding >OphauG2|3482
ATGCAGACATCAATGTCTCAGCTACCCGTGACCCGTCTTGGGCCAATGCACTGCCGCCAGCAGCAGTCGTCATAT
GAGCTAGAAACACCAATATCAAGGGTGCAAGACGATGCCCAGCTGCTGCGCTGGCAATGTTGCTTTGATTGCCAT
GAATCCAAGCCCGACAAGGATACATGTGTTGAGGCCTTTGTGAAGCTCGTCTCTCACCTTGTCATCCTCCAGGTT
GGCGAGGCGTACTGTATTCAAGACTCGAGACGCCGTGGTTTCATCTTGGCTCATCACATCGACGACGAGCACCAA
GCGCCTACTTTTATCAAGTGCCAAGATGGCCAAGATATTCCATCAGACTTTTCCATTGGCAAAGGAAAGGCCTTG
CAGCTCCATGTTGATGACGTCTCGGGACAAGTGTGGCTGGAAGCACTGCCCAATCTCGTACCTGAAGCAGCTCTT
GAGGCTCTGGGCCACATGCTACAAGACCTGATTGCTAGCCTGCAGCAGAGTCAAGAGAAACAATGCCAGCGCGAA
TGGACGCAATCGTCTCTGCTCAACATTCCACCGGCTGCGAGGCCCTTGGTTTTATTTCCTTACGAGTCGGTCTGT
TCGGGTCGTCTTGACCCTGAGCCCGCTCTTCTCCACCGTCAATTCGAGCAAAGAGCAGCAGAAACTCCTGAAAGA
ACGGCGCTAGACTTTCTCGTGGACCTTGAAAACGGCAACAGAATGCAATACACCTATCAGCAAGTGGACAACGCC
GCAAACGCTCTGGCAGCCGAATTGGCTCAATTATGCGCACAGTCGGGTATCAAGACAGCTGCCGTGCTTATTGGC
CCCAGCCCAGAGCTGTATGTCAGCTACCTAGCTGTTCTCAAGGCCGGCATGGCCTTTTGCCCTGTCCCCATGGAT
GTCCCCGAAGCCAGAAAAAAAGTGCTCATGGCAGACCTGAAGCCAGCAGTCCTCCTGGTGGCTACATCAGTACAT
TCAAGACCATGTGAATTTCGTACGCCAACCGTCACGATTGACGTGACTGGCCACCTTGTATCATGCAATACCAAA
TCCAAGACATGTTCCCTCGCCGCCGAGACGGATGTGGCCTACATCTTGTACACGTCAGGAAGCAGCGGCATGCCA
AAGGGGGTAGAAATCAGCCACATTGCTGCGTCTTGTACCATTTCAGCCCTCAGTGCTCACTGCGGCTTTCTTGCC
CAAGCAGATTCGGCATTGAGACCCATCAGGTGGTTCCAAGGCGCGGCTCCGACATTTGACATCTCCCTATTTGAA
ATATTTTGGACGCTGAGCACCGGCTCGACTCTTTGTTGCGCTCCGCGCGAGTTTATTCTTCAGGACATGAACAAA
GTCGTGGGCCACTTGAATGCCGATATCACCAACATCACTCCCAGTTTTGCCAGCCTTCTGGACCCGTCATTGCTG
CGCGGCCTGATGGTGGGCGGAGAGACACTAAACACAAGGCTCGTACGAGACTTTGCCTGCCACACCTCGAGTCGT
GGTCATAGTCAAGACAGACTTGGCGGCATCTACAACGGATATGGGCCTACAGAAACGGCCATTTACTGCATCGCC
CAGTCTCATGTCCCAGTAGAGCAGCGAGGCTCTGTGCTCGGTAAACCGCTGGCGACAAGTGGCATCATGATAGTG
GCGGAAAGAGCCAGGACCCTGCAGCCTGTGCCTATGGGTGCAATAGGAGAGCTTGTAGTCACTGGCCCGCAAGTC
AGCAGCACAGGCTACCTCAACCGCCCCGACGAGACGGCTCGCGTCTTCATAGACGATGCGCAATGGGGACGGGCG
TACAGAACGGGCGACCGAGCCCGGATTGTGTGGAACGACGCCGGCGAGCCCGTTGTAGAGTTTCTCGGTAGGATC
TCGGATGGCCAGGTCAAGCTCAGGGGAAGACGGGTAGAACTCGGCGAGGTTGACAAGGTGCTGGCGAGCAGAGTG
CAGGGCATACGGGAAATCCTGTCCTGTGTCTGGACCTTGGACAGGATTGTGACTCTGGTCGTGCTGGAGCCGCGT
GACGGCATCGTCGACTTTGGTCTTGTTCGCCAGAGATGTCTCGAGACGGCACAGCGGCATCTTCCCGACTACATG
AGACCCTTTCGCATCTTGCAGGTTGAGGCGCTGCCCAAGTCATCGTCTGGAAAGATTGATCGCAGGGCAGCCTCG
GCCTACGCACAGCAGACTGTTGGTAAAAGCCTTGAGCCGTTGCCAACGGTAGAGCCCTTGACGAACCCTCAAGAT
GCCAAGATGGAACAAGAGCTCGTTTGCATCCTTTCAGAGATGCTCCAATATAGCTGCAAACCCGCTCACGCGACC
CTGACGGCGGCCACGGCCCTCGACGAGGCTGGCCTGGACAGTCTAGGCGCCATGAGATTGTTGCGTGATATAAGG
CAGAAATGGCCCGCATGCCAAGACACGCGTTTGAATCCACCAATGGCTTTGCTTCTCAAGTCTGGAGCCAGCATC
CGCTCTGTCTTTTTCCCTTTGGTACAGGACATGGACAAGGAGGCCGAAACGCGACGCCAGCTCGCCCAACTGTCC
TCGAGACACATGTCGGAAGCTCTCAACAAGTTGAATCTTAGCAACGAGGCCGATATTGACTTGATTTTGCCGACA
ACATGTACCCAAAGTCAGCTGGCAGTGAGCTTTGCCATTAACCCTCAGAGCTATGTTAGCCATTCTGTCTTGAGA
ATAAAGCCTGGGGTCTCAGCCCAAGCCCTCACCAAGGCTGTCGAGACTGTTGTGTATCAACAAGCCATCTACCGA
TGTGCAATCCTTGCTGTACAAACCTCCTTGTCCCCCTTTATCCAGGTAGTCCTAGCACCTGAGGCCTGGCAACGG
CTCAATGAGAAGACGAGTCGGATCGTTCATAGGAGAGCGAGAAGAGCCTTGGTTTCCAATGAGGCACAAGAGTGG
CTTGACGTGGCTGAAAAGAATATGAGTCTGGATTCGCAGAGGCTGTACCACATTCAAATTGTTGAGTCAGACTCT
GCTTCCGACAGCACAAGCCTCTTGGTTATTAGCGTTGCTCACTGCATCTGCGACGGAGCCTCCATCGAGGTGCTC
ATGAGCGACATAGCCAGACAGATGGCTGGCCTAGAGCCTCTCCCCAGACATGGCATATACAATGTGGTGCTGGAG
TGGGCTTCGAATATTGAAGCCAAGACTGATGAGCTGTGGCAAGGGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTT
GGTTCACTCAGCGGCAACAAGGCCACGTCGCATTCTACTCATGGCCACGCAATGGTCCAATACGCCAGCGGCTTG
ACCTGGCAGGCCTTGCAAGATAAGAGTATTGCCCTTGGCGCCTCTCCCTTGACAGTTCTCCAGGCGTCTTGGGCT
CTTTTACTGCATTATTTTTCAGAGACGGATACAGAGCAAGTTGTATTTGGAAGCGTTATTTCGGGCCACAATGTC
CCGTCACACGCTCCCGCTTTTTCTGTTCTTCCCTGCCGGATCGCGCTGCCTGCGAACCAGACGGTCCGCCAGCTC
CTTGATGGCCTCACACGTGCCTCTCGCTTCACACAGAGCCGCCGACACACGTCGTTTGGCCTTTTCAAGACGCTT
CCATACACTACTGCGTTGGCCTTGCAAGTATATCCTCAACTGAGCCCTGAAGATGCCATTCCAGTTCCCTGGACC
GAGATTCAGAGGCCGGCGATGCGTTACGATCTGGCCATGTTTGTCGAGATCTTCCCCCAGGGCTTAGACTCGCTG
GGCCATCAACAAGAGTCCAACCAGATGACATTTAAACTCACATACCATCAGTATGCTCTTTCCGAGCTGGCAGCG
ACATGCATTGTCAAACAGCTTGACGCCTTGACAGAAGCCATTTTGGCTTCACATGCTCAAGATATGACTCAGGGA
CTCCCTGCTCACATACCTCAAAGGTTACTTTCTGTCCAAGGGACAAGAACTGCAGCTCGAGACAAGAAGCAAGCA
AGTCAGCTTCTACACGCCCAGTTTGAAGAGCAAGCTGTGTCAACTCCTCATCTACTGGCCCTAAGCTTCTACCCG
TCTCTAGACTCGCCTCGAGTCGATGTCAGCTATGCAGAGCTGGACGCAAGAGCCAATTCCCTGGCAGAAACGCTA
CGGGAGGAGGATGCCGAAATCATACCCATCTGTATGCACCGCAGTGTTGAGCTTTATGTCGCCGTCCTGGCAATC
CTGAAAGCCGGCTCAGCCTGGTGTCCTATCGATGAGACGTCTCCCTTGCAAAGACGCACCTCGCTCATTGCCAGG
ACACAGAGCAAGGTGTTAGTTACAAGCACGGACTCGCTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTC
GATGGAGTGCGCATGGTTCTCGTCGACCAGCACGCCCATGACAAGACACATGCAAAGCCAGAAGCACGCCCTGGT
GTCTTGTCTTTGGAATATCTCAGCGGGAAACATCTTGCCTATCTCCTGTGGACCTCTGGAACAACAGGAGAACCA
AAGGGCGTCATGATGCAACACTCGGCAGCGGCCCAAGCCATGCGTGACTTGCAGAGCCGAGTCGAGCATTGCAGC
GAGGCTGGACAGGTCCGGACCCTACAGCTCTCAGCCTACAGCTTTGACGTGTTTGTGCAAGACGTCTTCTACACA
TGGGGCGTGGCAGGCAGCGTCGTGAGCGGGCCCACAGAGCTTGTCCTGGGCAGCTTTGTCGACTTTGTCTGGAAG
TCGTGCCCGACACACGCTCATCTCACACCTTCATTCGGAGCCAGCATTACTGTTAATGACATCAAAGGCTCGACT
CTACAGCACGTGACATTTATTGGCGAGAAGCTAACGGAAGACGTTGCTGAAGCCTGGGCAGCGCCAGGCATCGCC
TCGCACACGTACAACACATACGGACCGGCTGAGAATGCCGTCGTGTCTACCATGAGACGCTTCTACGCCAAGGGC
CAGGATCAGGCCAAGGCAGCCAATGTAGGATTCCCCCTGAGCCAGTGTACCTCATATGTTGTCCGTGAGATCAGG
GCAGCGCAGGGCAAGCAGGATCGCTGGCAGCTTGTTCCTCGATACGGGGTTGGCGAGCTGGCTCTAGGTGGCGCT
CAAATGGCAAAGGGATACTTTGGTGACGCCGCCAAGACGGCCAAGGCCTTCATCGAAGGAGCAGGTGCCATCCAG
GAGCGCATCTATCTCACGGGGGACTTGGTGCGGCTCAACGACAACGGCGTCGAGTTCTTGGGCAGAAATGACGAC
TTGGTCAAGATTACGGGCATTCGAATTGAGCTGAGCGAGATCAGCGCCGCCTGTGCTGAGATCAAGAAGCAGGGA
GCAGCCATCGAACACGTCGAGACATTGCATCTCGAGCGTCCTGGAAGCGGCAACAAAGTCATTGTTGTCTTTGTC
TCGGTTAAGCAAGATTGCCTTGACACAGTGGAGCTTCGATCCAAGGTGTTCCAAAAGGCTCGAGACCTGCTGCCG
CAGTACATGGTTCCCGGCCACGTTGTTATTTTGAACACGACAATGCCGAGGACTGCGTCCAACAAGGTGAATCGC
AAGGCTCTGGAAGAAGTGTACCGGGCATCCGATTTGAAAGCCCTGGCTGCAGAGCATGGTAGCAAGCAGCAGCAG
TCCTGGACGGAGCAACAGCTCCAAGTCGTCCAAGTCATGGCCAACGTGGGCCAAGTGGCTGTCGAATCTTTGTCA
CCTCAAGATAGCTTGGCCGGCCTTGGTCTCAACTCTCTCGGTGTCACTAAGCTCGCGTGGACGTTGAGGCAACAC
CTCGAGTGCCATGTTGGAGTGATGGACCTACTACGCTGTCAAGTCACTGGCGAGCTGGTCGACCTTGTCCTCAGC
AAGCTGGCGCCGCCCGAAGAAGCCTCATGGCTGACTCGGATCAAGGATGCCTTGACCAAGGGACTGCATGGCAGT
ATGCGTCCAGCAGACACCTTGTCCGTGCTGCCAGCAACTCCAACGCAAGAGTCACTCATTGTAGAAACCATGATG
GAGCCCAGGGCCTACTGGGCACACCTTGTATTTGACATGAGTCACCTAGGCGCCGTAGACTGTCATGGGCTGAAA
GAGGCCTGGACTGCGGCCGCTGACAAGTTTGATATTCTGCGAACCATATTTGTTCCTCTGGCACAGCTCACTGTG
AATAATGGCGACCATGGCTGTATCAAATGGGCCCGTCAACAAGGGATTCATTCTACAATCCTTCAGCTTGTTCGC
AAAGAGCCCAGAGTGTGCTGGACGTGGCTATCTAGCCACGGTCACGCCAATCAAGACGATGATCTATCACAGTGG
GCTCAGAAGCTCCAAATGAAGCTGGCCCCCACAGCAACAGTCGAGCCTCCTTGGGCCGTGACCTATTCTGAGCGT
CAGGGCAAACTGATGCTGAGCATGCATCACGCCCTTTACGACGGTGTTTCCGGAGATATGCTCATGGACACGGTT
GCCAAACTCTACCAGAAGCAGGCTTTGGTTCAGGACGAGGCAATGATGCAGTTTGAACGGGGCATGGGACTTGGA
TTGCTCCCCATTGCCTCTCAAAGAAAAGAGGCTGCTTCACTGTGGAAGAAGTATCTGGACAAGATCAGAGAGACA
ACAGGTCCGCTTAACGCTGTCCTGCCGGACCTCACACAGTCTCGACAAGAGCAGCCGCGCAGAACTCTTGTGGCT
ACAAGATTACTGCCCTCTTCACTCGTCAAAGTGCCGCCGTCTACATCGTTTCCCCCTCTTCCTACGCTGCTTCAG
TCGGCGTTTGGATGCATTCTGGCATCGTATTTGGAGCTCAAAGCCGTTGTCATTGGCCACAACGTTTCGCTGAGG
TTGCTGCACTCAGGCCTGAGTCGCGTCATGGGCCCTGCCATGGCCACTGTTCCCCTCGTCATCCGTGCAGACAGT
GGCTCGGCCGAAGAGCTCTGGACCATGATGGCTTGCGAGTCGTCAACCTTGTTGCACAGCTTGCATAACCTACAT
CCTATTGACATTAGCAAATTGATCAATGACGGCCGTCATGGCAAGAATATCCCGTTTCCAGGTCTTTTTGTTTAT
CACCCGGCTTCCGACAGCAAGCATGGCGCTCAAGACATATTTCGCCAAGTAGGAGCAGCATTGACGTTTCATGTA
GAGCATCCTTTGGCTTTGAATGTATTCGAAGCTCAAGCAACTATAGAATTGACAGGGAATGCCAGTTGTATTTCA
CAGACACAGCTGGAGCTCATGTTGGATCAAATAATCCATCAGGCTCGTGCCATGACACAGTCACCTCGGAGCCGG
CTTGACCAAATTCAAAATACAATGGACCGACGCCTCATGTCTATTAGTGGCCAGGACACTACTCTCCTTTGTATG
CCTAAGCATGTGGATCCAACAGAGAGAGTCTCTGTCCATGCGTTGGAGAATCCTGAATGGATTGCCGCCGAGCAA
GTTGTTTGTCACGACGCTGAGATGGTTTCAAAAACCATTACCTACACTCAATTAGAAAAGCTGACCAACATCATG
GTCTCGAGATTGGCTTCACATGAGGCTGGCCTTGAGTCAGACGATATTGTCGCCATGTACATGGGAAGAGATATC
AAGTCGCTGGCTGTAACGTTGGCCATTTTCCGTGCCGGTTATGTCTACCTGGCAGTAGATGAGCAACTGCCCAAG
GCTCGAAAACAAGCCATGATTGGTGATTCAAAAGCGAAGCTCATCGTCACGACCGAGCAGCTCTCCAAGGATCTA
GACTTGAGCCTGGAAAGCGATGCTTGGGTCTTGATGCTGCCAGATGGTGAAAATGACATTGATGTCATGCTCTCC
TGGCCAACATCACCACTTGATGGTGAAATGGGCCTTGGGGGCTATCTCATCTACACATCGGGCTCTACCGGGCGT
CCCAAGGGCGTCCGCGTATCTAATGCCAACTTGTGTCATTTTATTGCCGCTATAAGCACTCGGATTACAGAGGCC
TCGCCCGTATCGGCTCGTCTCGGGGGCACGGGCAAGTATCTCAACCTAACGTCTCGGGCCTTTGATCCCCACCTA
ACGCAGATTTTTGTGCCCTGGAACCTAGGCTATAGAGTCGTCATTGGCAATAACTGGACAGCCATGCTTGGCAAC
TTGCAGCAAGTGATTAATCAGTTGGGCATCACGCATTTTGGATCTGTGCCATCTGTCCTGACGCGGCTCCGATTA
CGGCCCCAGGAGGTTTCCTCGGTCAAGGTGGTGACGACTGGAGGAGAAAAGGCTTCGACGGAGCTGCTTGACATG
TGGACAAGTGAGACGGAGAGTGGTGGCGACGACAAGGCTACTCTTATCAATTTCTACGGTCCAACGGAAGTGACG
ATAGGCTGTCTAGGCCAGGCTGTGGACCGGCATTCAACCCCTCGCAGCCTTGGAAAGCCGCTGGGGGATCTCGAG
GCTCTGCTTCTATGTCCCAATACCGGCATGGAGCAAGTCGTTGCCAGGAGGGGACAGGTCGGCGAGCTCTGCATG
CTGGGCCCCCAGGTAGCCCTGGGCTATCTCAACAGACCAATGGAGCAAGACAAGAGCTTTCAGACTACCTCTCTG
CTGGGACACGGTGTCAGGAGAATGTACCGAACAGGCGACATGATGAGAATGATGCACGACGGCACTCTCGAGTTC
CTGGGCAGGGCGGACCAGCAGGCCAAGATTCGGGGCCAGAGGCTCGAGCTAGACGAGATTGTGTCGTTTCTGAAA
CAAAGTGCCTCCCATGAGGGCCAAGTCGAGTTTGCTGCCGTTGTCTTGAATAATGAAGGCGTGTTGGGGTTTGCG
GCTCGCAGAACGGCTGCACTTGTGAGAGAGGAGATAGAGGCGGAAGCTGAGCTAGTCCAGAAGCCAGGCCGGGCG
ATATCGCGACTCCTTGAGAGACTGGAGCAAAAGTGTGAAGCTGGATTGCCTGCCTTTATGGTGCCCACCATGGTC
TGGGTGTCTCGGATTCCATATCTTGCTGCGTCGGGAAAGGTAGACACCAAATCTTTGACCAAGCTTGCTCACGAG
TTTGCCGCTTGCCAGCAAAATGAAGAGCGCCCAGACGCTCAGCAAGATGCTGCCCCGGGACATGATGACTTGAAG
ACGACGGAAAAGGTGGTAGCAGCGGCCATTGACGAGGTTCTGGGCGGTCAAGGCTGCACAAGTGGCATTCAGACA
AGGCCACAAAGCAGCCTCCATGGCCTAGGCATCGACAGTCTGTCAGCTCTTCATGTCGTGTCTCTGTTGCGAAAA
CGCGGCTTCCCCCATCTCACCATGGCCGACACAATGTCCTCGTCAAGCACGGTGGCCTCGATAGCTCGATTGGCT
GATGGCATGGCATCTCGGGCTCCTCAGCAGCCAAGCACAAGGACAATGCCAGTCCTCGGCCGGGCACATCTTGGT
CCAGCAGGAGCCGGCCTGGCCAATATAGCCATTGAGGCGGTTGTGCCGTGTCTGCCCCTACAGTCGGCCCTTGTT
GCTCAGTCTCTGCTCTGGGTGAGCGCAAACAGCCGCCGGGTTGAGGGTAGAAATGGAGACAGCACGGCGCTCGAC
GTGCCCTACGTGACGCAGTTTAGCTATCGTCTACCTCGCGGCTCTCAAGTCGCCAGATGGATCAAGGCAGCTGAG
CAACTTGTCGCGTCCGAGGCCATGCTGAGAAGTTGCTTTGTCCAGAATGGACAGATGCTTCAGGTTGTTTTGCAA
TGGTCGTCTCGTCTATCGCCCTTTGAAGGCGAACAAGACACGGCAGCCATGGTGGCCCAGATGAGTGTGCGACCG
CCCATTAGAATCCAGGTTCGCGAGGACCAGGACTCGGGCGAGATTGTCATGTCGTTCAAGATGCATCACGCCTTG
TTTGATCGAGTTGCCATTGACGTCTTGCGGAAGCGACTGGAGCAGAGCTATGAGGGCAGACGTGTTGTGGGCGGT
AGGAGCCTCGAGCTTCTTGAGAGCATCTCGAGCTACTGCCATGCTCTAGGCGGCCAAATGGAAGCAACAGCAAGG
CGAGAATGGGAGACCAGGCTGGCCAAGATGTACCCGTGTCGCGTCGGCGGAAATGGCAATGGCAATAACAAGACG
ACCAAGTCCATGGCTCGCTGGTCTCAATGCCTCAGCTACTCTGCTCAAGACCTCGCAACGGCCCTTTGTCTGGCC
CACACAACTCGGCAAGCCTCGATAGTATACGGCTTTGTCACGTCTCTCCGGCCTCTGCTCAGCCATGTCATTGGC
GATATCGACGACTTTATCGGCCCATGCCTCAACACGGTTGTTCACACGCTCAGCCTAGACAGAGGCGACGAGACG
CTGTCCAGTCTCGCCCACCGAGTCGGCGAGGCCCATGCAGCTGTCTGTCAGGGCGCCATGCCCCTTGTCAGTGTG
GAAAAGGTGCAGCGGTGGGCCGGATGCCAAGGCAAGCTGTGGGATAGTCTGCTGAGCATCAACCTGGTGACGCCT
CAAGAGCCCATGGAAAAAGGCAAAAGCCCGCCATGTCCAAGTGTCGAGAGCAGCAGCGACATGGCTCTGGCCATT
GATGTCGATGTGCATACCAATGGCAGAATCGTCCTGAATCTCTCTTCGGGTGGAGCTCTGGATCAACCACAGCTC
GACCGCCTTGGCCGGCTGTTTGAAAGGATTGTGGAAAGCTGTGCTGATGATGACACGGCCAGAGTCTCGCACTTT
GTTAGCCTGCCCAGCGACGTTGGATCCAAGGCCATTATTATTGCTCGAGACGCACAAGACGCGTTCCCACAAGAT
GAGCCATTTCAAGAGGCCATGGCTTGCGTTCAAGCAGCCCTTTGTCGCCTCCTAGACGTCAAGGCCTGTGACGTG
GCTGGCAAGACTTGGCTGTATCAGATTGGTCTCGACTCCATCAGCGTCTTTCCCCTGGTCTCGCTCATCAAACAG
ACGAGCAATGTGCAGCTCAACGCTGATGCAGTTCTCAAGGCGCGGAGCGTCATGGGCGTGGCCAGGCTTGTCCGC
CAGGCCAAGAGGGCCCTTGACAAGAGGGTCCTTGACAAGAGGGCCCTTGAGTCGGACAGGACAAGAGGCAACCCG
CGAGACAAGACAAGCGACAAGACTGTGCAACAGCTGGCCACCCAAGTCATGTTTGTGGCAACTCCTCTCCAGGCA
GGCATGCTGAGCGCATCGCTGGCCATTGCCGACAAGGCCTACACCTACACCCACAGGGTCCAGCTCTCGGCCCAC
GCTCTTGCGGCCGACACTGCTGGTCTCGACTGCCTCGTAGCCGCCGTCAGAGATACAGTACAGGCCTGTGAGATT
CTCAGGACGCATTTCATCTTTACCGCCCATGACGAGGCGCCGTGGATTGGCATTGTGTCTCGCAGCCAGCAGAGC
CATCTGGTGAGTTGGGAGACGCTTCCGAGTGGAAGGCTGAGTCTCACCATGCACCACGCGCTGTACGACGCCTCT
TCCCTCGAGGCCATGTGGGAGATGCTGCACCAATACTACTCGCAACATCTCCATGGCCATGGCCGTGGTCATGGC
GCAGCAACGGAGCATCTATTCAGGCCCTTTGCAGCAATGGTTAGTGCAGCACAGGAGGATTCAGTGGCCTTTTGG
TCCAGCCTGCTTCGAGACTACAGCTACACGCCGCTTGCCTTCCCCCACGACTCCTTGCAGACCTCTTGGGCTTTC
CACATGACCTTGGGCCAAGACGACTTGTCTCTTGTGCAAGCAAGATGCACAAGTCTCGGCGTGACAATCAAGGTG
GCATTTGAGCTGGCCTGGGTCAAGGTGTTGTGCCAGTCTCTCTACCGACAGGCCGATGTCGTCTATGGGCAAGTC
GTGTCTACTGCTGGCGCATGTAAACAAGCCGTGCTTGGTCCCACCATCAACACGGTTCCCATGCGCTTCAGCCTG
GTGGACAAGGACAGCTCCAAGGTGCTCAGCGTTGCAGAGGCCTTGGTTCGTCTGCAACGACTGAATGACGATGCA
AGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATCCAAACATTGTGGCGAAAGTCGAGCCAGGACCAGCGACGA
CTTCCGGCGACGCTGTTCCAAAGCCTCTTTGTGTTTGATGCCGTGGCTGCGCCTCTAGCACCACGATGCTTGTTT
ACGCCTGTGGACCATGAGACGCAAGCGACATATGACGACTATCCCTTGATTGTCAGTTTCCACATGCGAGGCAAG
ATTCTTGGCGTGAGGCTAAGAGCAAAAACGACTTCTAATCCAAGCCACCGCGTCGAGACTGTGGGCAAGGAGTTG
GACAAGACGGTCAAGTGGCTGTGTCAATGCAAACTCGACGACGACGTGGCAGCAATGGCCGACTTGGACTTGGAC
TCGAGCTCGACCACGCCGCCAGACTTGGACTTGAGCTCGGCAGTGGCAAAAACAGCAAACGCCATTCTCGCCCTA
GCAAAGACTGTCCTGGGCACAAAGATTTGCGCCAAGCACATTGGCCTCGCCACCCCGCTCGTCAACATGGGCCTC
GACTCCATCTTGGCCATTCGCCTATCTAGGCTTCTCAAGGAGCAACTGGGCATCAATGCCAGTGTCTTCCAGCTC
ACCAAGGGCGCCAGCATCCACGACTTGGTCAAGCCCATGGCGCCCACTGACCTAGCCAACAGTGAGACGCCGACC
AGGTCTCTGGTGACCGTCGGCGACGAGCTCAAGCCGCACATCTCAAAGCTCCTGCGACTGCAAGACGACGCCATG
GCAAGCATCCTGCCCGTCCTCGCAGGCCAGCGCGCACACCTTGAGCAGTGGCTGCACAGCGGCAAGAGATTCCTA
GAAGCGCCATGGGTCTATCGTGTCGAGACGCCGCCACTCGGCGCTGCCACAGTGGCGAGGTGCTGGACTGAGCTT
CGCCGCCTGCATCCAATTCTCCGAACCACATTTGTGTGCACAGGCGCCGACATGGCTCTGGTCCAAGTCACGCTG
AGCGAGCAGTGGGCAGCTCAGGGACGACGAGGCTTGGCCCATGTCCACGACGCCTCCAAGCCCATCCAAGCCCTT
ATCCAAGACCACCTTGTCGAGACGAATGCCGTGCCGTCAGACTTGATGGAGCCTCCGGCCCGTCTCTCCTTGCTC
GAGGGCCTGGGCGGCGAGGCGCTTGTACTCCGCCTTCACCACGCGCTATACGACGCCTGGACCATGGCCATGATT
GAAGACGACTTGGACAGGCTTCTGGCGTCGACTGAGCTTTGCCATGACACGACTCGGCACACGACGCCCGACACT
GCTGGGTCGCTACGCCAAGTTGTCTGCCAGATCAGAGACATGAGGCAGCGCGATGCTGAGGAGTCGTTTTGGAAA
CAGTACCTATCTGGCGCCCAGGACACTGTGCTGTCCATGGCCAGCCAGAGCAGCAATGCATGCTTGTCAACGACT
CGTGACTCGTCTCCCTTGGGCCCTCGCTTCAAGACGACCTACTCGGCTGCTGCAGCCTCGTCAAGCGTGAGCAAT
GCGAGCCTCTCGGCTGCCATTATTGTTGCCTATGCATCAACGCTGCGGCGCTTCACCACGGCCTCTCGGCCCACC
TTTGGCTTCAGCCACGCCTCTCGCGCGCTCTCTTCCCCCGACGGAACAAGCACGCTCGACTTGACAGCGGCCCGC
GTGCCGACGCTCACCCTGACGCCCATGTGTGTCGACGTGTGCCGCCCAGAGAAGCATCAGGTTGCGTCTGTGCAG
CACCACCTTGCTCAGCTCACAAAGTTTGCCCAGTCAGACCGAGTGCGCCAGTTTTGCCCTTGCTTCAACACGTAC
GTCAATATTGTCTTTGCCAGGGACAGTGTCGAGCATCCCTCTCCAAAGGTGCTCCGTAGGCACAGGCTCAGCGAA
CCGCTGGCTTCAGATTACTGGACCGTCGCCAAGCCCTGGCCTGACTCCGACTCTACTATTCAAGGGCTGGACACG
CAGCACTTGTGTCCTCATCAGTTCTTTTTCACCGTGGTTGTCTGTCCGAGCCGACATGTCAAAGTCACCGTCAGT
GGAGATGGAAGCGGCTTGGCCATGGTGACACAGTTGGTGTCGTATTTTGGCTCAGAGTTGGAGCGAATTCTCGAC
GACGACGCATTGCTAGAATAG
Transcript >OphauG2|3482
ATGCAGACATCAATGTCTCAGCTACCCGTGACCCGTCTTGGGCCAATGCACTGCCGCCAGCAGCAGTCGTCATAT
GAGCTAGAAACACCAATATCAAGGGTGCAAGACGATGCCCAGCTGCTGCGCTGGCAATGTTGCTTTGATTGCCAT
GAATCCAAGCCCGACAAGGATACATGTGTTGAGGCCTTTGTGAAGCTCGTCTCTCACCTTGTCATCCTCCAGGTT
GGCGAGGCGTACTGTATTCAAGACTCGAGACGCCGTGGTTTCATCTTGGCTCATCACATCGACGACGAGCACCAA
GCGCCTACTTTTATCAAGTGCCAAGATGGCCAAGATATTCCATCAGACTTTTCCATTGGCAAAGGAAAGGCCTTG
CAGCTCCATGTTGATGACGTCTCGGGACAAGTGTGGCTGGAAGCACTGCCCAATCTCGTACCTGAAGCAGCTCTT
GAGGCTCTGGGCCACATGCTACAAGACCTGATTGCTAGCCTGCAGCAGAGTCAAGAGAAACAATGCCAGCGCGAA
TGGACGCAATCGTCTCTGCTCAACATTCCACCGGCTGCGAGGCCCTTGGTTTTATTTCCTTACGAGTCGGTCTGT
TCGGGTCGTCTTGACCCTGAGCCCGCTCTTCTCCACCGTCAATTCGAGCAAAGAGCAGCAGAAACTCCTGAAAGA
ACGGCGCTAGACTTTCTCGTGGACCTTGAAAACGGCAACAGAATGCAATACACCTATCAGCAAGTGGACAACGCC
GCAAACGCTCTGGCAGCCGAATTGGCTCAATTATGCGCACAGTCGGGTATCAAGACAGCTGCCGTGCTTATTGGC
CCCAGCCCAGAGCTGTATGTCAGCTACCTAGCTGTTCTCAAGGCCGGCATGGCCTTTTGCCCTGTCCCCATGGAT
GTCCCCGAAGCCAGAAAAAAAGTGCTCATGGCAGACCTGAAGCCAGCAGTCCTCCTGGTGGCTACATCAGTACAT
TCAAGACCATGTGAATTTCGTACGCCAACCGTCACGATTGACGTGACTGGCCACCTTGTATCATGCAATACCAAA
TCCAAGACATGTTCCCTCGCCGCCGAGACGGATGTGGCCTACATCTTGTACACGTCAGGAAGCAGCGGCATGCCA
AAGGGGGTAGAAATCAGCCACATTGCTGCGTCTTGTACCATTTCAGCCCTCAGTGCTCACTGCGGCTTTCTTGCC
CAAGCAGATTCGGCATTGAGACCCATCAGGTGGTTCCAAGGCGCGGCTCCGACATTTGACATCTCCCTATTTGAA
ATATTTTGGACGCTGAGCACCGGCTCGACTCTTTGTTGCGCTCCGCGCGAGTTTATTCTTCAGGACATGAACAAA
GTCGTGGGCCACTTGAATGCCGATATCACCAACATCACTCCCAGTTTTGCCAGCCTTCTGGACCCGTCATTGCTG
CGCGGCCTGATGGTGGGCGGAGAGACACTAAACACAAGGCTCGTACGAGACTTTGCCTGCCACACCTCGAGTCGT
GGTCATAGTCAAGACAGACTTGGCGGCATCTACAACGGATATGGGCCTACAGAAACGGCCATTTACTGCATCGCC
CAGTCTCATGTCCCAGTAGAGCAGCGAGGCTCTGTGCTCGGTAAACCGCTGGCGACAAGTGGCATCATGATAGTG
GCGGAAAGAGCCAGGACCCTGCAGCCTGTGCCTATGGGTGCAATAGGAGAGCTTGTAGTCACTGGCCCGCAAGTC
AGCAGCACAGGCTACCTCAACCGCCCCGACGAGACGGCTCGCGTCTTCATAGACGATGCGCAATGGGGACGGGCG
TACAGAACGGGCGACCGAGCCCGGATTGTGTGGAACGACGCCGGCGAGCCCGTTGTAGAGTTTCTCGGTAGGATC
TCGGATGGCCAGGTCAAGCTCAGGGGAAGACGGGTAGAACTCGGCGAGGTTGACAAGGTGCTGGCGAGCAGAGTG
CAGGGCATACGGGAAATCCTGTCCTGTGTCTGGACCTTGGACAGGATTGTGACTCTGGTCGTGCTGGAGCCGCGT
GACGGCATCGTCGACTTTGGTCTTGTTCGCCAGAGATGTCTCGAGACGGCACAGCGGCATCTTCCCGACTACATG
AGACCCTTTCGCATCTTGCAGGTTGAGGCGCTGCCCAAGTCATCGTCTGGAAAGATTGATCGCAGGGCAGCCTCG
GCCTACGCACAGCAGACTGTTGGTAAAAGCCTTGAGCCGTTGCCAACGGTAGAGCCCTTGACGAACCCTCAAGAT
GCCAAGATGGAACAAGAGCTCGTTTGCATCCTTTCAGAGATGCTCCAATATAGCTGCAAACCCGCTCACGCGACC
CTGACGGCGGCCACGGCCCTCGACGAGGCTGGCCTGGACAGTCTAGGCGCCATGAGATTGTTGCGTGATATAAGG
CAGAAATGGCCCGCATGCCAAGACACGCGTTTGAATCCACCAATGGCTTTGCTTCTCAAGTCTGGAGCCAGCATC
CGCTCTGTCTTTTTCCCTTTGGTACAGGACATGGACAAGGAGGCCGAAACGCGACGCCAGCTCGCCCAACTGTCC
TCGAGACACATGTCGGAAGCTCTCAACAAGTTGAATCTTAGCAACGAGGCCGATATTGACTTGATTTTGCCGACA
ACATGTACCCAAAGTCAGCTGGCAGTGAGCTTTGCCATTAACCCTCAGAGCTATGTTAGCCATTCTGTCTTGAGA
ATAAAGCCTGGGGTCTCAGCCCAAGCCCTCACCAAGGCTGTCGAGACTGTTGTGTATCAACAAGCCATCTACCGA
TGTGCAATCCTTGCTGTACAAACCTCCTTGTCCCCCTTTATCCAGGTAGTCCTAGCACCTGAGGCCTGGCAACGG
CTCAATGAGAAGACGAGTCGGATCGTTCATAGGAGAGCGAGAAGAGCCTTGGTTTCCAATGAGGCACAAGAGTGG
CTTGACGTGGCTGAAAAGAATATGAGTCTGGATTCGCAGAGGCTGTACCACATTCAAATTGTTGAGTCAGACTCT
GCTTCCGACAGCACAAGCCTCTTGGTTATTAGCGTTGCTCACTGCATCTGCGACGGAGCCTCCATCGAGGTGCTC
ATGAGCGACATAGCCAGACAGATGGCTGGCCTAGAGCCTCTCCCCAGACATGGCATATACAATGTGGTGCTGGAG
TGGGCTTCGAATATTGAAGCCAAGACTGATGAGCTGTGGCAAGGGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTT
GGTTCACTCAGCGGCAACAAGGCCACGTCGCATTCTACTCATGGCCACGCAATGGTCCAATACGCCAGCGGCTTG
ACCTGGCAGGCCTTGCAAGATAAGAGTATTGCCCTTGGCGCCTCTCCCTTGACAGTTCTCCAGGCGTCTTGGGCT
CTTTTACTGCATTATTTTTCAGAGACGGATACAGAGCAAGTTGTATTTGGAAGCGTTATTTCGGGCCACAATGTC
CCGTCACACGCTCCCGCTTTTTCTGTTCTTCCCTGCCGGATCGCGCTGCCTGCGAACCAGACGGTCCGCCAGCTC
CTTGATGGCCTCACACGTGCCTCTCGCTTCACACAGAGCCGCCGACACACGTCGTTTGGCCTTTTCAAGACGCTT
CCATACACTACTGCGTTGGCCTTGCAAGTATATCCTCAACTGAGCCCTGAAGATGCCATTCCAGTTCCCTGGACC
GAGATTCAGAGGCCGGCGATGCGTTACGATCTGGCCATGTTTGTCGAGATCTTCCCCCAGGGCTTAGACTCGCTG
GGCCATCAACAAGAGTCCAACCAGATGACATTTAAACTCACATACCATCAGTATGCTCTTTCCGAGCTGGCAGCG
ACATGCATTGTCAAACAGCTTGACGCCTTGACAGAAGCCATTTTGGCTTCACATGCTCAAGATATGACTCAGGGA
CTCCCTGCTCACATACCTCAAAGGTTACTTTCTGTCCAAGGGACAAGAACTGCAGCTCGAGACAAGAAGCAAGCA
AGTCAGCTTCTACACGCCCAGTTTGAAGAGCAAGCTGTGTCAACTCCTCATCTACTGGCCCTAAGCTTCTACCCG
TCTCTAGACTCGCCTCGAGTCGATGTCAGCTATGCAGAGCTGGACGCAAGAGCCAATTCCCTGGCAGAAACGCTA
CGGGAGGAGGATGCCGAAATCATACCCATCTGTATGCACCGCAGTGTTGAGCTTTATGTCGCCGTCCTGGCAATC
CTGAAAGCCGGCTCAGCCTGGTGTCCTATCGATGAGACGTCTCCCTTGCAAAGACGCACCTCGCTCATTGCCAGG
ACACAGAGCAAGGTGTTAGTTACAAGCACGGACTCGCTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTC
GATGGAGTGCGCATGGTTCTCGTCGACCAGCACGCCCATGACAAGACACATGCAAAGCCAGAAGCACGCCCTGGT
GTCTTGTCTTTGGAATATCTCAGCGGGAAACATCTTGCCTATCTCCTGTGGACCTCTGGAACAACAGGAGAACCA
AAGGGCGTCATGATGCAACACTCGGCAGCGGCCCAAGCCATGCGTGACTTGCAGAGCCGAGTCGAGCATTGCAGC
GAGGCTGGACAGGTCCGGACCCTACAGCTCTCAGCCTACAGCTTTGACGTGTTTGTGCAAGACGTCTTCTACACA
TGGGGCGTGGCAGGCAGCGTCGTGAGCGGGCCCACAGAGCTTGTCCTGGGCAGCTTTGTCGACTTTGTCTGGAAG
TCGTGCCCGACACACGCTCATCTCACACCTTCATTCGGAGCCAGCATTACTGTTAATGACATCAAAGGCTCGACT
CTACAGCACGTGACATTTATTGGCGAGAAGCTAACGGAAGACGTTGCTGAAGCCTGGGCAGCGCCAGGCATCGCC
TCGCACACGTACAACACATACGGACCGGCTGAGAATGCCGTCGTGTCTACCATGAGACGCTTCTACGCCAAGGGC
CAGGATCAGGCCAAGGCAGCCAATGTAGGATTCCCCCTGAGCCAGTGTACCTCATATGTTGTCCGTGAGATCAGG
GCAGCGCAGGGCAAGCAGGATCGCTGGCAGCTTGTTCCTCGATACGGGGTTGGCGAGCTGGCTCTAGGTGGCGCT
CAAATGGCAAAGGGATACTTTGGTGACGCCGCCAAGACGGCCAAGGCCTTCATCGAAGGAGCAGGTGCCATCCAG
GAGCGCATCTATCTCACGGGGGACTTGGTGCGGCTCAACGACAACGGCGTCGAGTTCTTGGGCAGAAATGACGAC
TTGGTCAAGATTACGGGCATTCGAATTGAGCTGAGCGAGATCAGCGCCGCCTGTGCTGAGATCAAGAAGCAGGGA
GCAGCCATCGAACACGTCGAGACATTGCATCTCGAGCGTCCTGGAAGCGGCAACAAAGTCATTGTTGTCTTTGTC
TCGGTTAAGCAAGATTGCCTTGACACAGTGGAGCTTCGATCCAAGGTGTTCCAAAAGGCTCGAGACCTGCTGCCG
CAGTACATGGTTCCCGGCCACGTTGTTATTTTGAACACGACAATGCCGAGGACTGCGTCCAACAAGGTGAATCGC
AAGGCTCTGGAAGAAGTGTACCGGGCATCCGATTTGAAAGCCCTGGCTGCAGAGCATGGTAGCAAGCAGCAGCAG
TCCTGGACGGAGCAACAGCTCCAAGTCGTCCAAGTCATGGCCAACGTGGGCCAAGTGGCTGTCGAATCTTTGTCA
CCTCAAGATAGCTTGGCCGGCCTTGGTCTCAACTCTCTCGGTGTCACTAAGCTCGCGTGGACGTTGAGGCAACAC
CTCGAGTGCCATGTTGGAGTGATGGACCTACTACGCTGTCAAGTCACTGGCGAGCTGGTCGACCTTGTCCTCAGC
AAGCTGGCGCCGCCCGAAGAAGCCTCATGGCTGACTCGGATCAAGGATGCCTTGACCAAGGGACTGCATGGCAGT
ATGCGTCCAGCAGACACCTTGTCCGTGCTGCCAGCAACTCCAACGCAAGAGTCACTCATTGTAGAAACCATGATG
GAGCCCAGGGCCTACTGGGCACACCTTGTATTTGACATGAGTCACCTAGGCGCCGTAGACTGTCATGGGCTGAAA
GAGGCCTGGACTGCGGCCGCTGACAAGTTTGATATTCTGCGAACCATATTTGTTCCTCTGGCACAGCTCACTGTG
AATAATGGCGACCATGGCTGTATCAAATGGGCCCGTCAACAAGGGATTCATTCTACAATCCTTCAGCTTGTTCGC
AAAGAGCCCAGAGTGTGCTGGACGTGGCTATCTAGCCACGGTCACGCCAATCAAGACGATGATCTATCACAGTGG
GCTCAGAAGCTCCAAATGAAGCTGGCCCCCACAGCAACAGTCGAGCCTCCTTGGGCCGTGACCTATTCTGAGCGT
CAGGGCAAACTGATGCTGAGCATGCATCACGCCCTTTACGACGGTGTTTCCGGAGATATGCTCATGGACACGGTT
GCCAAACTCTACCAGAAGCAGGCTTTGGTTCAGGACGAGGCAATGATGCAGTTTGAACGGGGCATGGGACTTGGA
TTGCTCCCCATTGCCTCTCAAAGAAAAGAGGCTGCTTCACTGTGGAAGAAGTATCTGGACAAGATCAGAGAGACA
ACAGGTCCGCTTAACGCTGTCCTGCCGGACCTCACACAGTCTCGACAAGAGCAGCCGCGCAGAACTCTTGTGGCT
ACAAGATTACTGCCCTCTTCACTCGTCAAAGTGCCGCCGTCTACATCGTTTCCCCCTCTTCCTACGCTGCTTCAG
TCGGCGTTTGGATGCATTCTGGCATCGTATTTGGAGCTCAAAGCCGTTGTCATTGGCCACAACGTTTCGCTGAGG
TTGCTGCACTCAGGCCTGAGTCGCGTCATGGGCCCTGCCATGGCCACTGTTCCCCTCGTCATCCGTGCAGACAGT
GGCTCGGCCGAAGAGCTCTGGACCATGATGGCTTGCGAGTCGTCAACCTTGTTGCACAGCTTGCATAACCTACAT
CCTATTGACATTAGCAAATTGATCAATGACGGCCGTCATGGCAAGAATATCCCGTTTCCAGGTCTTTTTGTTTAT
CACCCGGCTTCCGACAGCAAGCATGGCGCTCAAGACATATTTCGCCAAGTAGGAGCAGCATTGACGTTTCATGTA
GAGCATCCTTTGGCTTTGAATGTATTCGAAGCTCAAGCAACTATAGAATTGACAGGGAATGCCAGTTGTATTTCA
CAGACACAGCTGGAGCTCATGTTGGATCAAATAATCCATCAGGCTCGTGCCATGACACAGTCACCTCGGAGCCGG
CTTGACCAAATTCAAAATACAATGGACCGACGCCTCATGTCTATTAGTGGCCAGGACACTACTCTCCTTTGTATG
CCTAAGCATGTGGATCCAACAGAGAGAGTCTCTGTCCATGCGTTGGAGAATCCTGAATGGATTGCCGCCGAGCAA
GTTGTTTGTCACGACGCTGAGATGGTTTCAAAAACCATTACCTACACTCAATTAGAAAAGCTGACCAACATCATG
GTCTCGAGATTGGCTTCACATGAGGCTGGCCTTGAGTCAGACGATATTGTCGCCATGTACATGGGAAGAGATATC
AAGTCGCTGGCTGTAACGTTGGCCATTTTCCGTGCCGGTTATGTCTACCTGGCAGTAGATGAGCAACTGCCCAAG
GCTCGAAAACAAGCCATGATTGGTGATTCAAAAGCGAAGCTCATCGTCACGACCGAGCAGCTCTCCAAGGATCTA
GACTTGAGCCTGGAAAGCGATGCTTGGGTCTTGATGCTGCCAGATGGTGAAAATGACATTGATGTCATGCTCTCC
TGGCCAACATCACCACTTGATGGTGAAATGGGCCTTGGGGGCTATCTCATCTACACATCGGGCTCTACCGGGCGT
CCCAAGGGCGTCCGCGTATCTAATGCCAACTTGTGTCATTTTATTGCCGCTATAAGCACTCGGATTACAGAGGCC
TCGCCCGTATCGGCTCGTCTCGGGGGCACGGGCAAGTATCTCAACCTAACGTCTCGGGCCTTTGATCCCCACCTA
ACGCAGATTTTTGTGCCCTGGAACCTAGGCTATAGAGTCGTCATTGGCAATAACTGGACAGCCATGCTTGGCAAC
TTGCAGCAAGTGATTAATCAGTTGGGCATCACGCATTTTGGATCTGTGCCATCTGTCCTGACGCGGCTCCGATTA
CGGCCCCAGGAGGTTTCCTCGGTCAAGGTGGTGACGACTGGAGGAGAAAAGGCTTCGACGGAGCTGCTTGACATG
TGGACAAGTGAGACGGAGAGTGGTGGCGACGACAAGGCTACTCTTATCAATTTCTACGGTCCAACGGAAGTGACG
ATAGGCTGTCTAGGCCAGGCTGTGGACCGGCATTCAACCCCTCGCAGCCTTGGAAAGCCGCTGGGGGATCTCGAG
GCTCTGCTTCTATGTCCCAATACCGGCATGGAGCAAGTCGTTGCCAGGAGGGGACAGGTCGGCGAGCTCTGCATG
CTGGGCCCCCAGGTAGCCCTGGGCTATCTCAACAGACCAATGGAGCAAGACAAGAGCTTTCAGACTACCTCTCTG
CTGGGACACGGTGTCAGGAGAATGTACCGAACAGGCGACATGATGAGAATGATGCACGACGGCACTCTCGAGTTC
CTGGGCAGGGCGGACCAGCAGGCCAAGATTCGGGGCCAGAGGCTCGAGCTAGACGAGATTGTGTCGTTTCTGAAA
CAAAGTGCCTCCCATGAGGGCCAAGTCGAGTTTGCTGCCGTTGTCTTGAATAATGAAGGCGTGTTGGGGTTTGCG
GCTCGCAGAACGGCTGCACTTGTGAGAGAGGAGATAGAGGCGGAAGCTGAGCTAGTCCAGAAGCCAGGCCGGGCG
ATATCGCGACTCCTTGAGAGACTGGAGCAAAAGTGTGAAGCTGGATTGCCTGCCTTTATGGTGCCCACCATGGTC
TGGGTGTCTCGGATTCCATATCTTGCTGCGTCGGGAAAGGTAGACACCAAATCTTTGACCAAGCTTGCTCACGAG
TTTGCCGCTTGCCAGCAAAATGAAGAGCGCCCAGACGCTCAGCAAGATGCTGCCCCGGGACATGATGACTTGAAG
ACGACGGAAAAGGTGGTAGCAGCGGCCATTGACGAGGTTCTGGGCGGTCAAGGCTGCACAAGTGGCATTCAGACA
AGGCCACAAAGCAGCCTCCATGGCCTAGGCATCGACAGTCTGTCAGCTCTTCATGTCGTGTCTCTGTTGCGAAAA
CGCGGCTTCCCCCATCTCACCATGGCCGACACAATGTCCTCGTCAAGCACGGTGGCCTCGATAGCTCGATTGGCT
GATGGCATGGCATCTCGGGCTCCTCAGCAGCCAAGCACAAGGACAATGCCAGTCCTCGGCCGGGCACATCTTGGT
CCAGCAGGAGCCGGCCTGGCCAATATAGCCATTGAGGCGGTTGTGCCGTGTCTGCCCCTACAGTCGGCCCTTGTT
GCTCAGTCTCTGCTCTGGGTGAGCGCAAACAGCCGCCGGGTTGAGGGTAGAAATGGAGACAGCACGGCGCTCGAC
GTGCCCTACGTGACGCAGTTTAGCTATCGTCTACCTCGCGGCTCTCAAGTCGCCAGATGGATCAAGGCAGCTGAG
CAACTTGTCGCGTCCGAGGCCATGCTGAGAAGTTGCTTTGTCCAGAATGGACAGATGCTTCAGGTTGTTTTGCAA
TGGTCGTCTCGTCTATCGCCCTTTGAAGGCGAACAAGACACGGCAGCCATGGTGGCCCAGATGAGTGTGCGACCG
CCCATTAGAATCCAGGTTCGCGAGGACCAGGACTCGGGCGAGATTGTCATGTCGTTCAAGATGCATCACGCCTTG
TTTGATCGAGTTGCCATTGACGTCTTGCGGAAGCGACTGGAGCAGAGCTATGAGGGCAGACGTGTTGTGGGCGGT
AGGAGCCTCGAGCTTCTTGAGAGCATCTCGAGCTACTGCCATGCTCTAGGCGGCCAAATGGAAGCAACAGCAAGG
CGAGAATGGGAGACCAGGCTGGCCAAGATGTACCCGTGTCGCGTCGGCGGAAATGGCAATGGCAATAACAAGACG
ACCAAGTCCATGGCTCGCTGGTCTCAATGCCTCAGCTACTCTGCTCAAGACCTCGCAACGGCCCTTTGTCTGGCC
CACACAACTCGGCAAGCCTCGATAGTATACGGCTTTGTCACGTCTCTCCGGCCTCTGCTCAGCCATGTCATTGGC
GATATCGACGACTTTATCGGCCCATGCCTCAACACGGTTGTTCACACGCTCAGCCTAGACAGAGGCGACGAGACG
CTGTCCAGTCTCGCCCACCGAGTCGGCGAGGCCCATGCAGCTGTCTGTCAGGGCGCCATGCCCCTTGTCAGTGTG
GAAAAGGTGCAGCGGTGGGCCGGATGCCAAGGCAAGCTGTGGGATAGTCTGCTGAGCATCAACCTGGTGACGCCT
CAAGAGCCCATGGAAAAAGGCAAAAGCCCGCCATGTCCAAGTGTCGAGAGCAGCAGCGACATGGCTCTGGCCATT
GATGTCGATGTGCATACCAATGGCAGAATCGTCCTGAATCTCTCTTCGGGTGGAGCTCTGGATCAACCACAGCTC
GACCGCCTTGGCCGGCTGTTTGAAAGGATTGTGGAAAGCTGTGCTGATGATGACACGGCCAGAGTCTCGCACTTT
GTTAGCCTGCCCAGCGACGTTGGATCCAAGGCCATTATTATTGCTCGAGACGCACAAGACGCGTTCCCACAAGAT
GAGCCATTTCAAGAGGCCATGGCTTGCGTTCAAGCAGCCCTTTGTCGCCTCCTAGACGTCAAGGCCTGTGACGTG
GCTGGCAAGACTTGGCTGTATCAGATTGGTCTCGACTCCATCAGCGTCTTTCCCCTGGTCTCGCTCATCAAACAG
ACGAGCAATGTGCAGCTCAACGCTGATGCAGTTCTCAAGGCGCGGAGCGTCATGGGCGTGGCCAGGCTTGTCCGC
CAGGCCAAGAGGGCCCTTGACAAGAGGGTCCTTGACAAGAGGGCCCTTGAGTCGGACAGGACAAGAGGCAACCCG
CGAGACAAGACAAGCGACAAGACTGTGCAACAGCTGGCCACCCAAGTCATGTTTGTGGCAACTCCTCTCCAGGCA
GGCATGCTGAGCGCATCGCTGGCCATTGCCGACAAGGCCTACACCTACACCCACAGGGTCCAGCTCTCGGCCCAC
GCTCTTGCGGCCGACACTGCTGGTCTCGACTGCCTCGTAGCCGCCGTCAGAGATACAGTACAGGCCTGTGAGATT
CTCAGGACGCATTTCATCTTTACCGCCCATGACGAGGCGCCGTGGATTGGCATTGTGTCTCGCAGCCAGCAGAGC
CATCTGGTGAGTTGGGAGACGCTTCCGAGTGGAAGGCTGAGTCTCACCATGCACCACGCGCTGTACGACGCCTCT
TCCCTCGAGGCCATGTGGGAGATGCTGCACCAATACTACTCGCAACATCTCCATGGCCATGGCCGTGGTCATGGC
GCAGCAACGGAGCATCTATTCAGGCCCTTTGCAGCAATGGTTAGTGCAGCACAGGAGGATTCAGTGGCCTTTTGG
TCCAGCCTGCTTCGAGACTACAGCTACACGCCGCTTGCCTTCCCCCACGACTCCTTGCAGACCTCTTGGGCTTTC
CACATGACCTTGGGCCAAGACGACTTGTCTCTTGTGCAAGCAAGATGCACAAGTCTCGGCGTGACAATCAAGGTG
GCATTTGAGCTGGCCTGGGTCAAGGTGTTGTGCCAGTCTCTCTACCGACAGGCCGATGTCGTCTATGGGCAAGTC
GTGTCTACTGCTGGCGCATGTAAACAAGCCGTGCTTGGTCCCACCATCAACACGGTTCCCATGCGCTTCAGCCTG
GTGGACAAGGACAGCTCCAAGGTGCTCAGCGTTGCAGAGGCCTTGGTTCGTCTGCAACGACTGAATGACGATGCA
AGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATCCAAACATTGTGGCGAAAGTCGAGCCAGGACCAGCGACGA
CTTCCGGCGACGCTGTTCCAAAGCCTCTTTGTGTTTGATGCCGTGGCTGCGCCTCTAGCACCACGATGCTTGTTT
ACGCCTGTGGACCATGAGACGCAAGCGACATATGACGACTATCCCTTGATTGTCAGTTTCCACATGCGAGGCAAG
ATTCTTGGCGTGAGGCTAAGAGCAAAAACGACTTCTAATCCAAGCCACCGCGTCGAGACTGTGGGCAAGGAGTTG
GACAAGACGGTCAAGTGGCTGTGTCAATGCAAACTCGACGACGACGTGGCAGCAATGGCCGACTTGGACTTGGAC
TCGAGCTCGACCACGCCGCCAGACTTGGACTTGAGCTCGGCAGTGGCAAAAACAGCAAACGCCATTCTCGCCCTA
GCAAAGACTGTCCTGGGCACAAAGATTTGCGCCAAGCACATTGGCCTCGCCACCCCGCTCGTCAACATGGGCCTC
GACTCCATCTTGGCCATTCGCCTATCTAGGCTTCTCAAGGAGCAACTGGGCATCAATGCCAGTGTCTTCCAGCTC
ACCAAGGGCGCCAGCATCCACGACTTGGTCAAGCCCATGGCGCCCACTGACCTAGCCAACAGTGAGACGCCGACC
AGGTCTCTGGTGACCGTCGGCGACGAGCTCAAGCCGCACATCTCAAAGCTCCTGCGACTGCAAGACGACGCCATG
GCAAGCATCCTGCCCGTCCTCGCAGGCCAGCGCGCACACCTTGAGCAGTGGCTGCACAGCGGCAAGAGATTCCTA
GAAGCGCCATGGGTCTATCGTGTCGAGACGCCGCCACTCGGCGCTGCCACAGTGGCGAGGTGCTGGACTGAGCTT
CGCCGCCTGCATCCAATTCTCCGAACCACATTTGTGTGCACAGGCGCCGACATGGCTCTGGTCCAAGTCACGCTG
AGCGAGCAGTGGGCAGCTCAGGGACGACGAGGCTTGGCCCATGTCCACGACGCCTCCAAGCCCATCCAAGCCCTT
ATCCAAGACCACCTTGTCGAGACGAATGCCGTGCCGTCAGACTTGATGGAGCCTCCGGCCCGTCTCTCCTTGCTC
GAGGGCCTGGGCGGCGAGGCGCTTGTACTCCGCCTTCACCACGCGCTATACGACGCCTGGACCATGGCCATGATT
GAAGACGACTTGGACAGGCTTCTGGCGTCGACTGAGCTTTGCCATGACACGACTCGGCACACGACGCCCGACACT
GCTGGGTCGCTACGCCAAGTTGTCTGCCAGATCAGAGACATGAGGCAGCGCGATGCTGAGGAGTCGTTTTGGAAA
CAGTACCTATCTGGCGCCCAGGACACTGTGCTGTCCATGGCCAGCCAGAGCAGCAATGCATGCTTGTCAACGACT
CGTGACTCGTCTCCCTTGGGCCCTCGCTTCAAGACGACCTACTCGGCTGCTGCAGCCTCGTCAAGCGTGAGCAAT
GCGAGCCTCTCGGCTGCCATTATTGTTGCCTATGCATCAACGCTGCGGCGCTTCACCACGGCCTCTCGGCCCACC
TTTGGCTTCAGCCACGCCTCTCGCGCGCTCTCTTCCCCCGACGGAACAAGCACGCTCGACTTGACAGCGGCCCGC
GTGCCGACGCTCACCCTGACGCCCATGTGTGTCGACGTGTGCCGCCCAGAGAAGCATCAGGTTGCGTCTGTGCAG
CACCACCTTGCTCAGCTCACAAAGTTTGCCCAGTCAGACCGAGTGCGCCAGTTTTGCCCTTGCTTCAACACGTAC
GTCAATATTGTCTTTGCCAGGGACAGTGTCGAGCATCCCTCTCCAAAGGTGCTCCGTAGGCACAGGCTCAGCGAA
CCGCTGGCTTCAGATTACTGGACCGTCGCCAAGCCCTGGCCTGACTCCGACTCTACTATTCAAGGGCTGGACACG
CAGCACTTGTGTCCTCATCAGTTCTTTTTCACCGTGGTTGTCTGTCCGAGCCGACATGTCAAAGTCACCGTCAGT
GGAGATGGAAGCGGCTTGGCCATGGTGACACAGTTGGTGTCGTATTTTGGCTCAGAGTTGGAGCGAATTCTCGAC
GACGACGCATTGCTAGAATAG
Gene >OphauG2|3482
ATGCAGACATCAATGTCTCAGCTACCCGTGACCCGTCTTGGGCCAATGCACTGCCGCCAGCAGCAGTCGTCATAT
GAGCTAGAAACACCAATATCAAGGGTGCAAGACGATGCCCAGCTGCTGCGCTGGCAATGTTGCTTTGATTGCCAT
GAATCCAAGCCCGACAAGGATACATGTGTTGAGGCCTTTGTGAAGCTCGTCTCTCACCTTGTCATCCTCCAGGTT
GGCGAGGCGTACTGTATTCAAGACTCGAGACGCCGTGGTTTCATCTTGGCTCATCACATCGACGACGAGCACCAA
GCGCCTACTTTTATCAAGTGCCAAGATGGCCAAGATATTCCATCAGACTTTTCCATTGGCAAAGGAAAGGTAAGT
CGAGAGCAGAGGCTGCAGATTTGTGCTGCATCATGGCGCTCATACCTATCTATCTAGGCCTTGCAGCTCCATGTT
GATGACGTCTCGGGACAAGTGTGGCTGGAAGCACTGCCCAATCTCGTACCTGAAGCAGCTCTTGAGGCTCTGGGC
CACATGCTACAAGACCTGATTGCTAGCCTGCAGCAGAGTCAAGAGAAACAATGCCAGCGCGAATGGACGCAATCG
TCTCTGCTCAACATTCCACCGGCTGCGAGGCCCTTGGTTTTATTTCCTTACGAGTCGGTCTGTTCGGGTCGTCTT
GACCCTGAGCCCGCTCTTCTCCACCGTCAATTCGAGCAAAGAGCAGCAGAAACTCCTGAAAGAACGGCGCTAGAC
TTTCTCGTGGACCTTGAAAACGGCAACAGAATGCAATACACCTATCAGCAAGTGGACAACGCCGCAAACGCTCTG
GCAGCCGAATTGGCTCAATTATGCGCACAGTCGGGTATCAAGACAGCTGCCGTGCTTATTGGCCCCAGCCCAGAG
CTGTATGTCAGCTACCTAGCTGTTCTCAAGGCCGGCATGGCCTTTTGCCCTGTCCCCATGGATGTCCCCGAAGCC
AGAAAAAAAGTGCTCATGGCAGACCTGAAGCCAGCAGTCCTCCTGGTGGCTACATCAGTACATTCAAGACCATGT
GAATTTCGTACGCCAACCGTCACGATTGACGTGACTGGCCACCTTGTATCATGCAATACCAAATCCAAGACATGT
TCCCTCGCCGCCGAGACGGATGTGGCCTACATCTTGTACACGTCAGGAAGCAGCGGCATGCCAAAGGGGGTAGAA
ATCAGCCACATTGCTGCGTCTTGTACCATTTCAGCCCTCAGTGCTCACTGCGGCTTTCTTGCCCAAGCAGATTCG
GCATTGAGACCCATCAGGTGGTTCCAAGGCGCGGCTCCGACATTTGACATCTCCCTATTTGAAATATTTTGGACG
CTGAGCACCGGCTCGACTCTTTGTTGCGCTCCGCGCGAGTTTATTCTTCAGGACATGAACAAAGTCGTGGGCCAC
TTGAATGCCGATATCACCAACATCACTCCCAGTTTTGCCAGCCTTCTGGACCCGTCATTGCTGCGCGGCCTGATG
GTGGGCGGAGAGACACTAAACACAAGGCTCGTACGAGACTTTGCCTGCCACACCTCGAGTCGTGGTCATAGTCAA
GACAGACTTGGCGGCATCTACAACGGATATGGGCCTACAGAAACGGCCATTTACTGCATCGCCCAGTCTCATGTC
CCAGTAGAGCAGCGAGGCTCTGTGCTCGGTAAACCGCTGGCGACAAGTGGCATCATGATAGTGGCGGAAAGAGCC
AGGACCCTGCAGCCTGTGCCTATGGGTGCAATAGGAGAGCTTGTAGTCACTGGCCCGCAAGTCAGCAGCACAGGC
TACCTCAACCGCCCCGACGAGACGGCTCGCGTCTTCATAGACGATGCGCAATGGGGACGGGCGTACAGAACGGGC
GACCGAGCCCGGATTGTGTGGAACGACGCCGGCGAGCCCGTTGTAGAGTTTCTCGGTAGGATCTCGGATGGCCAG
GTCAAGCTCAGGGGAAGACGGGTAGAACTCGGCGAGGTTGACAAGGTGCTGGCGAGCAGAGTGCAGGGCATACGG
GAAATCCTGTCCTGTGTCTGGACCTTGGACAGGATTGTGACTCTGGTCGTGCTGGAGCCGCGTGACGGCATCGTC
GACTTTGGTCTTGTTCGCCAGAGATGTCTCGAGACGGCACAGCGGCATCTTCCCGACTACATGAGACCCTTTCGC
ATCTTGCAGGTTGAGGCGCTGCCCAAGTCATCGTCTGGAAAGATTGATCGCAGGGCAGCCTCGGCCTACGCACAG
CAGACTGTTGGTAAAAGCCTTGAGCCGTTGCCAACGGTAGAGCCCTTGACGAACCCTCAAGATGCCAAGATGGAA
CAAGAGCTCGTTTGCATCCTTTCAGAGATGCTCCAATATAGCTGCAAACCCGCTCACGCGACCCTGACGGCGGCC
ACGGCCCTCGACGAGGCTGGCCTGGACAGTCTAGGCGCCATGAGATTGTTGCGTGATATAAGGCAGAAATGGCCC
GCATGCCAAGACACGCGTTTGAATCCACCAATGGCTTTGCTTCTCAAGTCTGGAGCCAGCATCCGCTCTGTCTTT
TTCCCTTTGGTACAGGACATGGACAAGGAGGCCGAAACGCGACGCCAGCTCGCCCAACTGTCCTCGAGACACATG
TCGGAAGCTCTCAACAAGTTGAATCTTAGCAACGAGGCCGATATTGACTTGATTTTGCCGACAACATGTACCCAA
AGTCAGCTGGCAGTGAGCTTTGCCATTAACCCTCAGAGCTATGTTAGCCATTCTGTCTTGAGAATAAAGCCTGGG
GTCTCAGCCCAAGCCCTCACCAAGGCTGTCGAGACTGTTGTGTATCAACAAGCCATCTACCGATGTGCAATCCTT
GCTGTACAAACCTCCTTGTCCCCCTTTATCCAGGTAGTCCTAGCACCTGAGGCCTGGCAACGGCTCAATGAGAAG
ACGAGTCGGATCGTTCATAGGAGAGCGAGAAGAGCCTTGGTTTCCAATGAGGCACAAGAGTGGCTTGACGTGGCT
GAAAAGAATATGAGTCTGGATTCGCAGAGGCTGTACCACATTCAAATTGTTGAGTCAGACTCTGCTTCCGACAGC
ACAAGCCTCTTGGTTATTAGCGTTGCTCACTGCATCTGCGACGGAGCCTCCATCGAGGTGCTCATGAGCGACATA
GCCAGACAGATGGCTGGCCTAGAGCCTCTCCCCAGACATGGCATATACAATGTGGTGCTGGAGTGGGCTTCGAAT
ATTGAAGCCAAGACTGATGAGCTGTGGCAAGGGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTTGGTTCACTCAGC
GGCAACAAGGCCACGTCGCATTCTACTCATGGCCACGCAATGGTCCAATACGCCAGCGGCTTGACCTGGCAGGCC
TTGCAAGATAAGAGTATTGCCCTTGGCGCCTCTCCCTTGACAGTTCTCCAGGCGTCTTGGGCTCTTTTACTGCAT
TATTTTTCAGAGACGGATACAGAGCAAGTTGTATTTGGAAGCGTTATTTCGGGCCACAATGTCCCGTCACACGCT
CCCGCTTTTTCTGTTCTTCCCTGCCGGATCGCGCTGCCTGCGAACCAGACGGTCCGCCAGCTCCTTGATGGCCTC
ACACGTGCCTCTCGCTTCACACAGAGCCGCCGACACACGTCGTTTGGCCTTTTCAAGACGCTTCCATACACTACT
GCGTTGGCCTTGCAAGTATATCCTCAACTGAGCCCTGAAGATGCCATTCCAGTTCCCTGGACCGAGATTCAGAGG
CCGGCGATGCGTTACGATCTGGCCATGTTTGTCGAGATCTTCCCCCAGGGCTTAGACTCGCTGGGCCATCAACAA
GAGTCCAACCAGATGACATTTAAACTCACATACCATCAGTATGCTCTTTCCGAGCTGGCAGCGACATGCATTGTC
AAACAGCTTGACGCCTTGACAGAAGCCATTTTGGCTTCACATGCTCAAGATATGACTCAGGGACTCCCTGCTCAC
ATACCTCAAAGGTTACTTTCTGTCCAAGGGACAAGAACTGCAGCTCGAGACAAGAAGCAAGCAAGTCAGCTTCTA
CACGCCCAGTTTGAAGAGCAAGCTGTGTCAACTCCTCATCTACTGGCCCTAAGCTTCTACCCGTCTCTAGACTCG
CCTCGAGTCGATGTCAGCTATGCAGAGCTGGACGCAAGAGCCAATTCCCTGGCAGAAACGCTACGGGAGGAGGAT
GCCGAAATCATACCCATCTGTATGCACCGCAGTGTTGAGCTTTATGTCGCCGTCCTGGCAATCCTGAAAGCCGGC
TCAGCCTGGTGTCCTATCGATGAGACGTCTCCCTTGCAAAGACGCACCTCGCTCATTGCCAGGACACAGAGCAAG
GTGTTAGTTACAAGCACGGACTCGCTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTCGATGGAGTGCGC
ATGGTTCTCGTCGACCAGCACGCCCATGACAAGACACATGCAAAGCCAGAAGCACGCCCTGGTGTCTTGTCTTTG
GAATATCTCAGCGGGAAACATCTTGCCTATCTCCTGTGGACCTCTGGAACAACAGGAGAACCAAAGGGCGTCATG
ATGCAACACTCGGCAGCGGCCCAAGCCATGCGTGACTTGCAGAGCCGAGTCGAGCATTGCAGCGAGGCTGGACAG
GTCCGGACCCTACAGCTCTCAGCCTACAGCTTTGACGTGTTTGTGCAAGACGTCTTCTACACATGGGGCGTGGCA
GGCAGCGTCGTGAGCGGGCCCACAGAGCTTGTCCTGGGCAGCTTTGTCGACTTTGTCTGGAAGTCGTGCCCGACA
CACGCTCATCTCACACCTTCATTCGGAGCCAGCATTACTGTTAATGACATCAAAGGCTCGACTCTACAGCACGTG
ACATTTATTGGCGAGAAGCTAACGGAAGACGTTGCTGAAGCCTGGGCAGCGCCAGGCATCGCCTCGCACACGTAC
AACACATACGGACCGGCTGAGAATGCCGTCGTGTCTACCATGAGACGCTTCTACGCCAAGGGCCAGGATCAGGCC
AAGGCAGCCAATGTAGGATTCCCCCTGAGCCAGTGTACCTCATATGTTGTCCGTGAGATCAGGGCAGCGCAGGGC
AAGCAGGATCGCTGGCAGCTTGTTCCTCGATACGGGGTTGGCGAGCTGGCTCTAGGTGGCGCTCAAATGGCAAAG
GGATACTTTGGTGACGCCGCCAAGACGGCCAAGGCCTTCATCGAAGGAGCAGGTGCCATCCAGGAGCGCATCTAT
CTCACGGGGGACTTGGTGCGGCTCAACGACAACGGCGTCGAGTTCTTGGGCAGAAATGACGACTTGGTCAAGATT
ACGGGCATTCGAATTGAGCTGAGCGAGATCAGCGCCGCCTGTGCTGAGATCAAGAAGCAGGGAGCAGCCATCGAA
CACGTCGAGACATTGCATCTCGAGCGTCCTGGAAGCGGCAACAAAGTCATTGTTGTCTTTGTCTCGGTTAAGCAA
GATTGCCTTGACACAGTGGAGCTTCGATCCAAGGTGTTCCAAAAGGCTCGAGACCTGCTGCCGCAGTACATGGTT
CCCGGCCACGTTGTTATTTTGAACACGACAATGCCGAGGACTGCGTCCAACAAGGTGAATCGCAAGGCTCTGGAA
GAAGTGTACCGGGCATCCGATTTGAAAGCCCTGGCTGCAGAGCATGGTAGCAAGCAGCAGCAGTCCTGGACGGAG
CAACAGCTCCAAGTCGTCCAAGTCATGGCCAACGTGGGCCAAGTGGCTGTCGAATCTTTGTCACCTCAAGATAGC
TTGGCCGGCCTTGGTCTCAACTCTCTCGGTGTCACTAAGCTCGCGTGGACGTTGAGGCAACACCTCGAGTGCCAT
GTTGGAGTGATGGACCTACTACGCTGTCAAGTCACTGGCGAGCTGGTCGACCTTGTCCTCAGCAAGCTGGCGCCG
CCCGAAGAAGCCTCATGGCTGACTCGGATCAAGGATGCCTTGACCAAGGGACTGCATGGCAGTATGCGTCCAGCA
GACACCTTGTCCGTGCTGCCAGCAACTCCAACGCAAGAGTCACTCATTGTAGAAACCATGATGGAGCCCAGGGCC
TACTGGGCACACCTTGTATTTGACATGAGTCACCTAGGCGCCGTAGACTGTCATGGGCTGAAAGAGGCCTGGACT
GCGGCCGCTGACAAGTTTGATATTCTGCGAACCATATTTGTTCCTCTGGCACAGCTCACTGTGAATAATGGCGAC
CATGGCTGTATCAAATGGGCCCGTCAACAAGGGATTCATTCTACAATCCTTCAGCTTGTTCGCAAAGAGCCCAGA
GTGTGCTGGACGTGGCTATCTAGCCACGGTCACGCCAATCAAGACGATGATCTATCACAGTGGGCTCAGAAGCTC
CAAATGAAGCTGGCCCCCACAGCAACAGTCGAGCCTCCTTGGGCCGTGACCTATTCTGAGCGTCAGGGCAAACTG
ATGCTGAGCATGCATCACGCCCTTTACGACGGTGTTTCCGGAGATATGCTCATGGACACGGTTGCCAAACTCTAC
CAGAAGCAGGCTTTGGTTCAGGACGAGGCAATGATGCAGTTTGAACGGGGCATGGGACTTGGATTGCTCCCCATT
GCCTCTCAAAGAAAAGAGGCTGCTTCACTGTGGAAGAAGTATCTGGACAAGATCAGAGAGACAACAGGTCCGCTT
AACGCTGTCCTGCCGGACCTCACACAGTCTCGACAAGAGCAGCCGCGCAGAACTCTTGTGGCTACAAGATTACTG
CCCTCTTCACTCGTCAAAGTGCCGCCGTCTACATCGTTTCCCCCTCTTCCTACGCTGCTTCAGTCGGCGTTTGGA
TGCATTCTGGCATCGTATTTGGAGCTCAAAGCCGTTGTCATTGGCCACAACGTTTCGCTGAGGTTGCTGCACTCA
GGCCTGAGTCGCGTCATGGGCCCTGCCATGGCCACTGTTCCCCTCGTCATCCGTGCAGACAGTGGCTCGGCCGAA
GAGCTCTGGACCATGATGGCTTGCGAGTCGTCAACCTTGTTGCACAGCTTGCATAACCTACATCCTATTGACATT
AGCAAATTGATCAATGACGGCCGTCATGGCAAGAATATCCCGTTTCCAGGTCTTTTTGTTTATCACCCGGCTTCC
GACAGCAAGCATGGCGCTCAAGACATATTTCGCCAAGTAGGAGCAGCATTGACGTTTCATGTAGAGCATCCTTTG
GCTTTGAATGTATTCGAAGCTCAAGCAACTATAGAATTGACAGGGAATGCCAGTTGTATTTCACAGACACAGCTG
GAGCTCATGTTGGATCAAATAATCCATCAGGCTCGTGCCATGACACAGTCACCTCGGAGCCGGCTTGACCAAATT
CAAAATACAATGGACCGACGCCTCATGTCTATTAGTGGCCAGGACACTACTCTCCTTTGTATGCCTAAGCATGTG
GATCCAACAGAGAGAGTCTCTGTCCATGCGTTGGAGAATCCTGAATGGATTGCCGCCGAGCAAGTTGTTTGTCAC
GACGCTGAGATGGTTTCAAAAACCATTACCTACACTCAATTAGAAAAGCTGACCAACATCATGGTCTCGAGATTG
GCTTCACATGAGGCTGGCCTTGAGTCAGACGATATTGTCGCCATGTACATGGGAAGAGATATCAAGTCGCTGGCT
GTAACGTTGGCCATTTTCCGTGCCGGTTATGTCTACCTGGCAGTAGATGAGCAACTGCCCAAGGCTCGAAAACAA
GCCATGATTGGTGATTCAAAAGCGAAGCTCATCGTCACGACCGAGCAGCTCTCCAAGGATCTAGACTTGAGCCTG
GAAAGCGATGCTTGGGTCTTGATGCTGCCAGATGGTGAAAATGACATTGATGTCATGCTCTCCTGGCCAACATCA
CCACTTGATGGTGAAATGGGCCTTGGGGGCTATCTCATCTACACATCGGGCTCTACCGGGCGTCCCAAGGGCGTC
CGCGTATCTAATGCCAACTTGTGTCATTTTATTGCCGCTATAAGCACTCGGATTACAGAGGCCTCGCCCGTATCG
GCTCGTCTCGGGGGCACGGGCAAGTATCTCAACCTAACGTCTCGGGCCTTTGATCCCCACCTAACGCAGATTTTT
GTGCCCTGGAACCTAGGCTATAGAGTCGTCATTGGCAATAACTGGACAGCCATGCTTGGCAACTTGCAGCAAGTG
ATTAATCAGTTGGGCATCACGCATTTTGGATCTGTGCCATCTGTCCTGACGCGGCTCCGATTACGGCCCCAGGAG
GTTTCCTCGGTCAAGGTGGTGACGACTGGAGGAGAAAAGGCTTCGACGGAGCTGCTTGACATGTGGACAAGTGAG
ACGGAGAGTGGTGGCGACGACAAGGCTACTCTTATCAATTTCTACGGTCCAACGGAAGTGACGATAGGCTGTCTA
GGCCAGGCTGTGGACCGGCATTCAACCCCTCGCAGCCTTGGAAAGCCGCTGGGGGATCTCGAGGCTCTGCTTCTA
TGTCCCAATACCGGCATGGAGCAAGTCGTTGCCAGGAGGGGACAGGTCGGCGAGCTCTGCATGCTGGGCCCCCAG
GTAGCCCTGGGCTATCTCAACAGACCAATGGAGCAAGACAAGAGCTTTCAGACTACCTCTCTGCTGGGACACGGT
GTCAGGAGAATGTACCGAACAGGCGACATGATGAGAATGATGCACGACGGCACTCTCGAGTTCCTGGGCAGGGCG
GACCAGCAGGCCAAGATTCGGGGCCAGAGGCTCGAGCTAGACGAGATTGTGTCGTTTCTGAAACAAAGTGCCTCC
CATGAGGGCCAAGTCGAGTTTGCTGCCGTTGTCTTGAATAATGAAGGCGTGTTGGGGTTTGCGGCTCGCAGAACG
GCTGCACTTGTGAGAGAGGAGATAGAGGCGGAAGCTGAGCTAGTCCAGAAGCCAGGCCGGGCGATATCGCGACTC
CTTGAGAGACTGGAGCAAAAGTGTGAAGCTGGATTGCCTGCCTTTATGGTGCCCACCATGGTCTGGGTGTCTCGG
ATTCCATATCTTGCTGCGTCGGGAAAGGTAGACACCAAATCTTTGACCAAGCTTGCTCACGAGTTTGCCGCTTGC
CAGCAAAATGAAGAGCGCCCAGACGCTCAGCAAGATGCTGCCCCGGGACATGATGACTTGAAGACGACGGAAAAG
GTGGTAGCAGCGGCCATTGACGAGGTTCTGGGCGGTCAAGGCTGCACAAGTGGCATTCAGACAAGGCCACAAAGC
AGCCTCCATGGCCTAGGCATCGACAGTCTGTCAGCTCTTCATGTCGTGTCTCTGTTGCGAAAACGCGGCTTCCCC
CATCTCACCATGGCCGACACAATGTCCTCGTCAAGCACGGTGGCCTCGATAGCTCGATTGGCTGATGGCATGGCA
TCTCGGGCTCCTCAGCAGCCAAGCACAAGGACAATGCCAGTCCTCGGCCGGGCACATCTTGGTCCAGCAGGAGCC
GGCCTGGCCAATATAGCCATTGAGGCGGTTGTGCCGTGTCTGCCCCTACAGTCGGCCCTTGTTGCTCAGTCTCTG
CTCTGGGTGAGCGCAAACAGCCGCCGGGTTGAGGGTAGAAATGGAGACAGCACGGCGCTCGACGTGCCCTACGTG
ACGCAGTTTAGCTATCGTCTACCTCGCGGCTCTCAAGTCGCCAGATGGATCAAGGCAGCTGAGCAACTTGTCGCG
TCCGAGGCCATGCTGAGAAGTTGCTTTGTCCAGAATGGACAGATGCTTCAGGTTGTTTTGCAATGGTCGTCTCGT
CTATCGCCCTTTGAAGGCGAACAAGACACGGCAGCCATGGTGGCCCAGATGAGTGTGCGACCGCCCATTAGAATC
CAGGTTCGCGAGGACCAGGACTCGGGCGAGATTGTCATGTCGTTCAAGATGCATCACGCCTTGTTTGATCGAGTT
GCCATTGACGTCTTGCGGAAGCGACTGGAGCAGAGCTATGAGGGCAGACGTGTTGTGGGCGGTAGGAGCCTCGAG
CTTCTTGAGAGCATCTCGAGCTACTGCCATGCTCTAGGCGGCCAAATGGAAGCAACAGCAAGGCGAGAATGGGAG
ACCAGGCTGGCCAAGATGTACCCGTGTCGCGTCGGCGGAAATGGCAATGGCAATAACAAGACGACCAAGTCCATG
GCTCGCTGGTCTCAATGCCTCAGCTACTCTGCTCAAGACGTCAGGCGTCAGTCTCGACACTCAGTCTCTACTGTT
TTGCAGCTCGCAACGGCCCTTTGTCTGGCCCACACAACTCGGCAAGCCTCGATAGTATACGGCTTTGTCACGTCT
CTCCGGCCTCTGCTCAGCCATGTCATTGGCGATATCGACGACTTTATCGGCCCATGCCTCAACACGGTTGTTCAC
ACGCTCAGCCTAGACAGAGGCGACGAGACGCTGTCCAGTCTCGCCCACCGAGTCGGCGAGGCCCATGCAGCTGTC
TGTCAGGGCGCCATGCCCCTTGTCAGTGTGGAAAAGGTGCAGCGGTGGGCCGGATGCCAAGGCAAGCTGTGGGAT
AGTCTGCTGAGCATCAACCTGGTGACGCCTCAAGAGCCCATGGAAAAAGGCAAAAGCCCGCCATGTCCAAGTGTC
GAGAGCAGCAGCGACATGGCTCTGGCCATTGATGTCGATGTGCATACCAATGGCAGAATCGTCCTGAATCTCTCT
TCGGGTGGAGCTCTGGATCAACCACAGCTCGACCGCCTTGGCCGGCTGTTTGAAAGGATTGTGGAAAGCTGTGCT
GATGATGACACGGCCAGAGTCTCGCACTTTGTTAGCCTGCCCAGCGACGTTGGATCCAAGGCCATTATTATTGCT
CGAGACGCACAAGACGCGTTCCCACAAGATGAGCCATTTCAAGAGGCCATGGCTTGCGTTCAAGCAGCCCTTTGT
CGCCTCCTAGACGTCAAGGCCTGTGACGTGGCTGGCAAGACTTGGCTGTATCAGATTGGTCTCGACTCCATCAGC
GTCTTTCCCCTGGTCTCGCTCATCAAACAGACGAGCAATGTGCAGCTCAACGCTGATGCAGTTCTCAAGGCGCGG
AGCGTCATGGGCGTGGCCAGGCTTGTCCGCCAGGCCAAGAGGGCCCTTGACAAGAGGGTCCTTGACAAGAGGGCC
CTTGAGTCGGACAGGACAAGAGGCAACCCGCGAGACAAGACAAGCGACAAGACTGTGCAACAGCTGGCCACCCAA
GTCATGTTTGTGGCAACTCCTCTCCAGGCAGGCATGCTGAGCGCATCGCTGGCCATTGCCGACAAGGCCTACACC
TACACCCACAGGGTCCAGCTCTCGGCCCACGCTCTTGCGGCCGACACTGCTGGTCTCGACTGCCTCGTAGCCGCC
GTCAGAGATACAGTACAGGCCTGTGAGATTCTCAGGACGCATTTCATCTTTACCGCCCATGACGAGGCGCCGTGG
ATTGGCATTGTGTCTCGCAGCCAGCAGAGCCATCTGGTGAGTTGGGAGACGCTTCCGAGTGGAAGGCTGAGTCTC
ACCATGCACCACGCGCTGTACGACGCCTCTTCCCTCGAGGCCATGTGGGAGATGCTGCACCAATACTACTCGCAA
CATCTCCATGGCCATGGCCGTGGTCATGGCGCAGCAACGGAGCATCTATTCAGGCCCTTTGCAGCAATGGTTAGT
GCAGCACAGGAGGATTCAGTGGCCTTTTGGTCCAGCCTGCTTCGAGACTACAGCTACACGCCGCTTGCCTTCCCC
CACGACTCCTTGCAGACCTCTTGGGCTTTCCACATGACCTTGGGCCAAGACGACTTGTCTCTTGTGCAAGCAAGA
TGCACAAGTCTCGGCGTGACAATCAAGGTGGCATTTGAGCTGGCCTGGGTCAAGGTGTTGTGCCAGTCTCTCTAC
CGACAGGCCGATGTCGTCTATGGGCAAGTCGTGTCTACTGCTGGCGCATGTAAACAAGCCGTGCTTGGTCCCACC
ATCAACACGGTTCCCATGCGCTTCAGCCTGGTGGACAAGGACAGCTCCAAGGTGCTCAGCGTTGCAGAGGCCTTG
GTTCGTCTGCAACGACTGAATGACGATGCAAGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATCCAAACATTG
TGGCGAAAGTCGAGCCAGGACCAGCGACGACTTCCGGCGACGCTGTTCCAAAGCCTCTTTGTGTTTGATGCCGTG
GCTGCGCCTCTAGCACCACGATGCTTGTTTACGCCTGTGGACCATGAGACGCAAGCGACATATGACGACTATCCC
TTGATTGTCAGTTTCCACATGCGAGGCAAGATTCTTGGCGTGAGGCTAAGAGCAAAAACGACTTCTAATCCAAGC
CACCGCGTCGAGACTGTGGGCAAGGAGTTGGACAAGACGGTCAAGTGGCTGTGTCAATGCAAACTCGACGACGAC
GTGGCAGCAATGGCCGACTTGGACTTGGACTCGAGCTCGACCACGCCGCCAGACTTGGACTTGAGCTCGGCAGTG
GCAAAAACAGCAAACGCCATTCTCGCCCTAGCAAAGACTGTCCTGGGCACAAAGATTTGCGCCAAGCACATTGGC
CTCGCCACCCCGCTCGTCAACATGGGCCTCGACTCCATCTTGGCCATTCGCCTATCTAGGCTTCTCAAGGAGCAA
CTGGGCATCAATGCCAGTGTCTTCCAGCTCACCAAGGGCGCCAGCATCCACGACTTGGTCAAGCCCATGGCGCCC
ACTGACCTAGCCAACAGTGAGACGCCGACCAGGTCTCTGGTGACCGTCGGCGACGAGCTCAAGCCGCACATCTCA
AAGCTCCTGCGACTGCAAGACGACGCCATGGCAAGCATCCTGCCCGTCCTCGCAGGCCAGCGCGCACACCTTGAG
CAGTGGCTGCACAGCGGCAAGAGATTCCTAGAAGCGCCATGGGTCTATCGTGTCGAGACGCCGCCACTCGGCGCT
GCCACAGTGGCGAGGTGCTGGACTGAGCTTCGCCGCCTGCATCCAATTCTCCGAACCACATTTGTGTGCACAGGC
GCCGACATGGCTCTGGTCCAAGTCACGCTGAGCGAGCAGTGGGCAGCTCAGGGACGACGAGGCTTGGCCCATGTC
CACGACGCCTCCAAGCCCATCCAAGCCCTTATCCAAGACCACCTTGTCGAGACGAATGCCGTGCCGTCAGACTTG
ATGGAGCCTCCGGCCCGTCTCTCCTTGCTCGAGGGCCTGGGCGGCGAGGCGCTTGTACTCCGCCTTCACCACGCG
CTATACGACGCCTGGACCATGGCCATGATTGAAGACGACTTGGACAGGCTTCTGGCGTCGACTGAGCTTTGCCAT
GACACGACTCGGCACACGACGCCCGACACTGCTGGGTCGCTACGCCAAGTTGTCTGCCAGATCAGAGACATGAGG
CAGCGCGATGCTGAGGAGTCGTTTTGGAAACAGTACCTATCTGGCGCCCAGGACACTGTGCTGTCCATGGCCAGC
CAGAGCAGCAATGCATGCTTGTCAACGACTCGTGACTCGTCTCCCTTGGGCCCTCGCTTCAAGACGACCTACTCG
GCTGCTGCAGCCTCGTCAAGCGTGAGCAATGCGAGCCTCTCGGCTGCCATTATTGTTGCCTATGCATCAACGCTG
CGGCGCTTCACCACGGCCTCTCGGCCCACCTTTGGCTTCAGCCACGCCTCTCGCGCGCTCTCTTCCCCCGACGGA
ACAAGCACGCTCGACTTGACAGCGGCCCGCGTGCCGACGCTCACCCTGACGCCCATGTGTGTCGACGTGTGCCGC
CCAGAGAAGCATCAGGTTGCGTCTGTGCAGCACCACCTTGCTCAGCTCACAAAGTTTGCCCAGTCAGACCGAGTG
CGCCAGTTTTGCCCTTGCTTCAACACGTACGTCAATATTGTCTTTGCCAGGGACAGTGTCGAGCATCCCTCTCCA
AAGGTGCTCCGTAGGCACAGGCTCAGCGAACCGCTGGCTTCAGATTACTGGACCGTCGCCAAGCCCTGGCCTGAC
TCCGACTCTACTATTCAAGGGCTGGACACGCAGCACTTGTGTCCTCATCAGTTCTTTTTCACCGTGGTTGTCTGT
CCGAGCCGACATGTCAAAGTCACCGTCAGTGGAGATGGAAGCGGCTTGGCCATGGTGACACAGTTGGTGTCGTAT
TTTGGCTCAGAGTTGGAGCGAATTCTCGACGACGACGCATTGCTAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail