Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3481
Gene name
LocationContig_264:20087..20915
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.0E-17 33 111
PF01822 WSC WSC domain 7.4E-15 164 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 257 7.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 31 256 3.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 12 257 3.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 34 256 1.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 120 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 257 7.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 31 256 3.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 12 257 3.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 34 256 1.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 120 2.0E-14
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 33 119 1.0E-13
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 134 263 4.0E-13
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 134 257 1.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 34 259 2.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 163 266 5.0E-12
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 156 256 9.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 163 271 9.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 163 271 5.0E-11
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 154 263 1.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 163 266 4.0E-10
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 163 263 5.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 34 154 8.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 34 119 8.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 163 256 1.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 22 119 3.0E-06
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 34 212 4.0E-06
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 34 140 6.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 34 118 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3481
MRASWRLVALALVAAADDTAQTNKTVVGSYTLQGCWTEATDSRALIGDAMASDGMTLEVCAQKCSGFIYFGAEYG
RECYCGDSLQDGSVKAKHQQDCFFPCAGDASEYCGGSQRLQLYRRPSVTTPPIPLPTNSSSGQPPPTSSLSVPPT
GPIVWPGNAQFDFYSCVSEPSKGRLLASQVLNDGDNMTVERCLEACDSYEWAGVEYGRECWCDDKLNWAGDGGAT
PARNVSQAECNMPCPGDRSVSCGGGLRLSLYSSKSSQPPGRVGEAVDANS*
Coding >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA
Transcript >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA
Gene >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail