Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3481
Gene name
LocationContig_264:20087..20915
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.0E-17 33 111
PF01822 WSC WSC domain 7.4E-15 164 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 257 7.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 31 256 3.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 12 257 3.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 34 256 1.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 120 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 257 7.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 31 256 3.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 12 257 3.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 34 256 1.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 30 120 2.0E-14
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 33 119 1.0E-13
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 134 263 4.0E-13
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 134 257 1.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 34 259 2.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 163 266 5.0E-12
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 156 256 9.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 163 271 9.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 163 271 5.0E-11
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 154 263 1.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 163 266 4.0E-10
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 163 263 5.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 34 154 8.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 34 119 8.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 163 256 1.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 22 119 3.0E-06
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 34 212 4.0E-06
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 34 140 6.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 34 118 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.998834

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4826
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3481 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3393
Ophiocordyceps australis map64 (Brazil) OphauB2|510
Ophiocordyceps australis map64 (Brazil) OphauB2|6706
Ophiocordyceps subramaniannii Hirsu2|10702

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3481
MRASWRLVALALVAAADDTAQTNKTVVGSYTLQGCWTEATDSRALIGDAMASDGMTLEVCAQKCSGFIYFGAEYG
RECYCGDSLQDGSVKAKHQQDCFFPCAGDASEYCGGSQRLQLYRRPSVTTPPIPLPTNSSSGQPPPTSSLSVPPT
GPIVWPGNAQFDFYSCVSEPSKGRLLASQVLNDGDNMTVERCLEACDSYEWAGVEYGRECWCDDKLNWAGDGGAT
PARNVSQAECNMPCPGDRSVSCGGGLRLSLYSSKSSQPPGRVGEAVDANS*
Coding >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA
Transcript >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA
Gene >OphauG2|3481
ATGAGAGCGTCCTGGCGTCTTGTGGCTCTGGCTCTCGTGGCCGCGGCCGACGACACTGCTCAAACAAACAAGACC
GTCGTCGGCTCCTACACCTTGCAGGGCTGCTGGACCGAAGCAACAGACAGCCGTGCCTTGATCGGGGATGCCATG
GCAAGCGACGGCATGACTCTCGAGGTTTGTGCACAGAAATGCAGCGGCTTCATCTATTTCGGAGCCGAGTACGGA
CGCGAATGCTACTGTGGCGACAGTCTCCAGGATGGAAGCGTCAAAGCCAAGCATCAGCAAGACTGCTTTTTCCCC
TGCGCCGGCGACGCGAGCGAATACTGCGGCGGCAGCCAAAGACTGCAGCTATACAGACGCCCGTCTGTCACCACG
CCTCCAATCCCGCTGCCCACCAACTCTTCCTCTGGCCAGCCGCCGCCCACGTCGTCGCTGTCTGTTCCGCCCACG
GGCCCCATTGTATGGCCCGGGAATGCCCAATTCGACTTTTACTCTTGCGTCTCGGAGCCGTCCAAGGGCCGTCTG
CTCGCTTCTCAGGTGCTCAACGATGGCGACAACATGACGGTCGAGCGCTGTCTCGAAGCCTGCGATAGTTATGAA
TGGGCTGGGGTGGAATATGGGCGAGAGTGCTGGTGTGACGACAAGCTTAACTGGGCTGGCGATGGAGGCGCTACA
CCCGCCAGAAACGTCTCGCAGGCAGAGTGCAACATGCCCTGTCCTGGAGACAGAAGTGTCTCTTGCGGTGGTGGG
CTCAGGCTCAGTCTGTATTCCAGCAAGTCATCTCAGCCGCCGGGGCGAGTTGGAGAAGCTGTTGATGCAAATTCT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail