Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3480
Gene name
LocationContig_264:17890..19494
Strand-
Gene length (bp)1604
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 1.2E-156 49 469

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 75 470 2.0E-45

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3480
MFPLALRSRGSFARPLYRAASTATTASPKRQGNISDSFWSFSGSERPLLPDRFRRLKLDLIQGHQQDVVESWATL
VQRLNEENALVAEKGCKIIPQVEFRHLERDCRELKSEILKRGVVLVRGVMPEQEARAYKEQIEEYARQNPHTRAF
PQSDPQVFELYWSEAQLKARSHPNLVRLQRHLLTSFWKTSSDTSHISLKNPLTYADRLRIRQPGDTSFALGPHID
GGSVERWEKEGYGKGGVYDDIFQGKWEAYDAWDASGRVNAVNNLYHGLGACSMFRPWQGWLSISHSGPRQGTLLV
NPLMELTTAYILLRPFFEPLARARGPGFLDNSNWRLTARSRMTSELQGATPGHGLELNDHDHAHLQLESTMVHIP
DTKPGDYVAWHCDTIHAVDKQHQGTSDSSVLYIPVCPVTTLNAQYLVRQRDAFRRGTPGPDFPGGQGESQHVGRP
TEEAFRGWSTAEGRQAFGLDRLEAGPDATSGETRAIEDANAILGF*
Coding >OphauG2|3480
ATGTTTCCTTTGGCTCTTCGCTCTCGAGGGAGCTTCGCGCGCCCCTTGTACAGAGCGGCATCAACCGCCACCACG
GCTTCGCCCAAGAGACAAGGCAACATCTCAGACTCATTCTGGTCCTTTTCTGGCTCAGAGAGACCGTTGTTGCCA
GATAGGTTTCGTCGGCTCAAATTAGACCTCATCCAAGGCCATCAACAAGACGTTGTAGAGAGCTGGGCCACCCTG
GTGCAAAGACTCAACGAGGAAAACGCCTTGGTCGCTGAAAAAGGATGCAAAATTATTCCTCAGGTTGAGTTTCGG
CATCTTGAGAGAGACTGTCGGGAACTCAAGTCTGAAATCTTGAAGAGGGGTGTCGTCCTTGTCCGAGGCGTCATG
CCCGAGCAAGAAGCCCGAGCCTACAAGGAACAAATTGAAGAATACGCCCGGCAGAACCCACACACGCGAGCTTTT
CCGCAAAGCGATCCCCAAGTCTTTGAGCTCTACTGGTCCGAGGCTCAGCTCAAGGCGCGCTCTCATCCAAACCTT
GTGCGGCTTCAGCGCCATCTCCTGACGTCGTTTTGGAAAACGTCGTCGGATACAAGTCACATCTCTCTCAAGAAC
CCACTGACGTATGCCGATAGGCTTCGGATCCGCCAGCCCGGGGATACTTCCTTTGCTCTCGGACCTCATATCGAC
GGCGGTAGCGTTGAGCGGTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATGATATTTTCCAGGGCAAA
TGGGAAGCGTACGATGCTTGGGACGCCAGCGGCAGAGTCAATGCCGTCAACAATCTTTACCATGGGCTCGGGGCA
TGTTCCATGTTTCGGCCATGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGGCAGGGGACGCTTCTGGTG
AACCCGCTGATGGAATTGACTACGGCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGGCAAGGGCTAGAGGC
CCGGGGTTCCTGGACAACAGCAACTGGCGCTTGACAGCACGGTCGAGAATGACGAGTGAGCTCCAAGGGGCAACG
CCGGGCCACGGGCTGGAACTCAACGACCATGACCATGCTCATCTCCAGCTCGAGAGCACAATGGTGCATATTCCC
GACACCAAGCCGGGTGATTATGTGGCATGGCACTGTGACACCATCCACGCGGTCGACAAGCAACATCAAGGCACG
TCTGATTCCAGCGTGCTCTACATACCAGTGTGTCCTGTGACGACTCTCAATGCCCAGTACTTGGTCCGCCAACGC
GATGCTTTCCGGAGAGGGACGCCGGGGCCCGATTTCCCTGGCGGCCAAGGCGAGTCGCAGCACGTTGGACGGCCG
ACAGAAGAAGCATTTCGGGGGTGGAGCACAGCCGAGGGACGACAAGCATTTGGGCTTGACAGGCTGGAAGCTGGG
CCCGACGCCACAAGCGGCGAAACAAGGGCGATTGAAGATGCAAACGCGATTCTGGGTTTCTAA
Transcript >OphauG2|3480
ATGTTTCCTTTGGCTCTTCGCTCTCGAGGGAGCTTCGCGCGCCCCTTGTACAGAGCGGCATCAACCGCCACCACG
GCTTCGCCCAAGAGACAAGGCAACATCTCAGACTCATTCTGGTCCTTTTCTGGCTCAGAGAGACCGTTGTTGCCA
GATAGGTTTCGTCGGCTCAAATTAGACCTCATCCAAGGCCATCAACAAGACGTTGTAGAGAGCTGGGCCACCCTG
GTGCAAAGACTCAACGAGGAAAACGCCTTGGTCGCTGAAAAAGGATGCAAAATTATTCCTCAGGTTGAGTTTCGG
CATCTTGAGAGAGACTGTCGGGAACTCAAGTCTGAAATCTTGAAGAGGGGTGTCGTCCTTGTCCGAGGCGTCATG
CCCGAGCAAGAAGCCCGAGCCTACAAGGAACAAATTGAAGAATACGCCCGGCAGAACCCACACACGCGAGCTTTT
CCGCAAAGCGATCCCCAAGTCTTTGAGCTCTACTGGTCCGAGGCTCAGCTCAAGGCGCGCTCTCATCCAAACCTT
GTGCGGCTTCAGCGCCATCTCCTGACGTCGTTTTGGAAAACGTCGTCGGATACAAGTCACATCTCTCTCAAGAAC
CCACTGACGTATGCCGATAGGCTTCGGATCCGCCAGCCCGGGGATACTTCCTTTGCTCTCGGACCTCATATCGAC
GGCGGTAGCGTTGAGCGGTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATGATATTTTCCAGGGCAAA
TGGGAAGCGTACGATGCTTGGGACGCCAGCGGCAGAGTCAATGCCGTCAACAATCTTTACCATGGGCTCGGGGCA
TGTTCCATGTTTCGGCCATGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGGCAGGGGACGCTTCTGGTG
AACCCGCTGATGGAATTGACTACGGCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGGCAAGGGCTAGAGGC
CCGGGGTTCCTGGACAACAGCAACTGGCGCTTGACAGCACGGTCGAGAATGACGAGTGAGCTCCAAGGGGCAACG
CCGGGCCACGGGCTGGAACTCAACGACCATGACCATGCTCATCTCCAGCTCGAGAGCACAATGGTGCATATTCCC
GACACCAAGCCGGGTGATTATGTGGCATGGCACTGTGACACCATCCACGCGGTCGACAAGCAACATCAAGGCACG
TCTGATTCCAGCGTGCTCTACATACCAGTGTGTCCTGTGACGACTCTCAATGCCCAGTACTTGGTCCGCCAACGC
GATGCTTTCCGGAGAGGGACGCCGGGGCCCGATTTCCCTGGCGGCCAAGGCGAGTCGCAGCACGTTGGACGGCCG
ACAGAAGAAGCATTTCGGGGGTGGAGCACAGCCGAGGGACGACAAGCATTTGGGCTTGACAGGCTGGAAGCTGGG
CCCGACGCCACAAGCGGCGAAACAAGGGCGATTGAAGATGCAAACGCGATTCTGGGTTTCTAA
Gene >OphauG2|3480
ATGTTTCCTTTGGCTCTTCGCTCTCGAGGGAGCTTCGCGCGCCCCTTGTACAGAGCGGCATCAACCGCCACCACG
GCTTCGCCCAAGAGACAAGGCAACATCTCAGACTCATTCTGGTCCTTTTCTGGCTCAGAGAGACCGTTGTTGCCA
GATAGGTTTCGTCGGCTCAAATTAGACCTCATCCAAGGCCATCAACAAGACGTTGTAGAGAGCTGGGCCACCCTG
GTGCAAAGACTCAACGAGGAAAACGCCTTGGTCGCTGAAAAAGGATGCAAAATTATTCCTCAGGTTGAGTTTCGG
CATCTTGAGAGAGACTGTCGGGAACTCAAGTCTGAAATCTTGAAGAGGGGTGTCGTCCTTGTCCGAGGCGTCATG
CCCGAGCAAGAAGCCCGAGCCTACAAGGAACAAATTGAAGAATACGCCCGGCAGAACCCACACACGCGAGGTCAG
TTGAGCTTCACTCCAGCATGTTTTGGGCGAGAGAGGTTCTGAAAGAGCTCCCTGCAGCTTTTCCGCAAAGCGATC
CCCAAGTCTTTGAGCTCTACTGGTCCGAGGCTCAGCTCAAGGCGCGCTCTCATCCAAACCTTGTGCGGCTTCAGC
GCCATCTCCTGACGTCGTTTTGGAAAACGTCGTCGGATACAAGTCACATCTCTCTCAAGAACCCACTGACGTATG
CCGATAGGCTTCGGATCCGCCAGCCCGGGGATACTTCCTTTGCTCTCGGACCTCATATCGACGGCGGTAGCGTTG
AGCGGTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATGATATTTTCCAGGGCAAATGGGAAGCGTACG
ATGCTTGGGACGCCAGCGGCAGAGTCAATGCCGTCAACAATCTTTACCATGGGCTCGGGGCATGTTCCATGTTTC
GGCCATGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGGCAGGGGACGCTTCTGGTGAACCCGCTGATGG
AATTGACTACGGCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGGCAAGGGCTAGAGGCCCGGGGTTCCTGG
ACAACAGCAACTGGCGCTTGACAGCACGGTCGAGAATGACGAGTGAGCTCCAAGGGGCAACGCCGGGCCACGGGC
TGGAACTCAACGACCATGACCATGCTCATCTCCAGCTCGAGAGCACAATGGTGCATATTCCCGACACCAAGCCGG
GTGATTATGTGGCATGGCACTGTGACAGTAATGGCCAATGGACTGTTGCCCGGGAAACAAGGATTGCTGACCATG
CCATAGCCATCCACGCGGTCGACAAGCAACATCAAGGCACGTCTGATTCCAGCGTGCTCTACATACCAGTGTGTC
CTGTGACGACTCTCAATGCCCAGTACTTGGTCCGCCAACGCGATGCTTTCCGGAGAGGGACGCCGGGGCCCGATT
TCCCTGGCGGCCAAGGCGAGTCGCAGCACGTTGGACGGCCGACAGAAGAAGCATTTCGGGGGTGGAGCACAGCCG
AGGGACGACAAGCATTTGGGCTTGACAGGCTGGAAGCTGGGCCCGACGCCACAAGCGGCGAAACAAGGGCGATTG
AAGATGCAAACGCGATTCTGGGTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail