Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3463
Gene name
LocationContig_262:9642..14954
Strand+
Gene length (bp)5312
Transcript length (bp)5067
Coding sequence length (bp)5067
Protein length (aa) 1689

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00637 Clathrin Region in Clathrin and VPS 1.7E-23 546 685
PF00637 Clathrin Region in Clathrin and VPS 6.1E-20 696 833
PF00637 Clathrin Region in Clathrin and VPS 1.9E-27 847 970
PF00637 Clathrin Region in Clathrin and VPS 2.9E-28 988 1127
PF00637 Clathrin Region in Clathrin and VPS 3.3E-29 1137 1275
PF00637 Clathrin Region in Clathrin and VPS 2.3E-30 1282 1426
PF00637 Clathrin Region in Clathrin and VPS 3.4E-31 1432 1573
PF13838 Clathrin_H_link Clathrin-H-link 4.1E-32 359 424
PF01394 Clathrin_propel Clathrin propeller repeat 1.1E-06 154 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49951|CLH1_BOVIN Clathrin heavy chain 1 OS=Bos taurus GN=CLTC PE=1 SV=1 4 1687 0.0E+00
sp|Q0WNJ6|CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana GN=CHC1 PE=1 SV=1 5 1639 0.0E+00
sp|Q0WLB5|CLAH2_ARATH Clathrin heavy chain 2 OS=Arabidopsis thaliana GN=CHC2 PE=1 SV=1 5 1639 0.0E+00
sp|P25870|CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum GN=chcA PE=1 SV=1 1 1670 0.0E+00
sp|Q2QYW2|CLH2_ORYSJ Clathrin heavy chain 2 OS=Oryza sativa subsp. japonica GN=Os12g0104800 PE=3 SV=1 5 1636 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49951|CLH1_BOVIN Clathrin heavy chain 1 OS=Bos taurus GN=CLTC PE=1 SV=1 4 1687 0.0E+00
sp|Q0WNJ6|CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana GN=CHC1 PE=1 SV=1 5 1639 0.0E+00
sp|Q0WLB5|CLAH2_ARATH Clathrin heavy chain 2 OS=Arabidopsis thaliana GN=CHC2 PE=1 SV=1 5 1639 0.0E+00
sp|P25870|CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum GN=chcA PE=1 SV=1 1 1670 0.0E+00
sp|Q2QYW2|CLH2_ORYSJ Clathrin heavy chain 2 OS=Oryza sativa subsp. japonica GN=Os12g0104800 PE=3 SV=1 5 1636 0.0E+00
sp|Q2RBN7|CLH1_ORYSJ Clathrin heavy chain 1 OS=Oryza sativa subsp. japonica GN=Os11g0104900 PE=3 SV=1 5 1636 0.0E+00
sp|P34574|CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans GN=chc-1 PE=3 SV=1 4 1670 0.0E+00
sp|P53675|CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 4 1636 0.0E+00
sp|P22137|CLH_YEAST Clathrin heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHC1 PE=1 SV=1 1 1645 0.0E+00
sp|P29742|CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster GN=Chc PE=1 SV=1 3 1671 0.0E+00
sp|P11442|CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus GN=Cltc PE=1 SV=3 4 1687 0.0E+00
sp|Q68FD5|CLH1_MOUSE Clathrin heavy chain 1 OS=Mus musculus GN=Cltc PE=1 SV=3 4 1687 0.0E+00
sp|Q00610|CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 4 1687 0.0E+00
sp|Q10161|CLH_SCHPO Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chc1 PE=1 SV=1 4 1656 0.0E+00
sp|Q5XIR8|CLHC1_RAT Clathrin heavy chain linker domain-containing protein 1 OS=Rattus norvegicus GN=Clhc1 PE=2 SV=1 367 532 6.0E-09
sp|Q8NHS4|CLHC1_HUMAN Clathrin heavy chain linker domain-containing protein 1 OS=Homo sapiens GN=CLHC1 PE=1 SV=3 367 521 4.0E-07
sp|Q4R6I5|CLHC1_MACFA Clathrin heavy chain linker domain-containing protein 1 OS=Macaca fascicularis GN=CLHC1 PE=2 SV=1 367 510 4.0E-07
sp|Q5M6W3|CLHC1_MOUSE Clathrin heavy chain linker domain-containing protein 1 OS=Mus musculus GN=Clhc1 PE=2 SV=1 367 642 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0006886 intracellular protein transport Yes
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0033036 macromolecule localization No
GO:0009987 cellular process No
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0070727 cellular macromolecule localization No
GO:0071705 nitrogen compound transport No
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0051234 establishment of localization No
GO:0045184 establishment of protein localization No
GO:0008104 protein localization No
GO:0015031 protein transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3463
MAPLPIKFQEQVQLTNVGVEPQSIGFNSCTLESDSFVCIREKKSDAAQPEVVIVELKNGNNVTRRPIKADSAIMH
WSRQVIALKAQSRTLQIFDLEEKKKLKSCTMNEDVQFWKWISQTTLGLVTTSSVYHWDVYDSSQEAPAKVFERNA
NLTGCQIINYRANADGKWMVLVGISSQQNRVVGAMQLYSKDRGISQAIEGHAACFGSIRLEGAPQDTKIFSFAVR
TAVGAKLHIVEVDHAESNPVFQKKAVDMFFPAEVPNDFPVALQISQKYGIIFVVTKYGFVHIYDLESGTTIFMNR
ISSETIFTTCGDSDSTGLLGINRKGQVLFVTIDESTIIPYLLENPLHSEIAIRLAARAGLPGADSLYAQQFDQLF
NSGNYQEAAKVAANSPRGFLRTAETIDKFKKIPSQPGQITVALQYFGMLLDKGGLNRHESLELAQPVLQQNRKHL
LEKWLKEGKLDCSEQLGDLVRVHDVNMALSIYLKANAPQKVVAGFAETGQFDKILPYAAQTGYQPDYIQLLQHII
RTNPERGGEFASALANSDQGPLVDYDRVCDIFQSQGMVQQATAFLLDALKENKPEHARLQTRLLEMNLMHAPQVA
EAILSNDMFTHFDRSRIAQLCEQAGLAQKALELYEDPESIKRVIVNIPGNPNFDPEFLTNFFGKLSVEQSLDCLD
AMMRHNIRQNLSSVVAIATKYSELLGPVQLIDLFEKYKTAEGLFYYLGSIINISNDPDVHYKYIEAAARSNQINE
VERICRESQFYNPEKVKNFLKEARLPELTPLIIVCDRFNFVHELVLYLYQHQHFEAIEKFVQLINPSRTPAVVGG
LLDVDCEENIIKQLLSTVDPQRINIDELVAEVESRNRLKILLPFLETTLQAGNQQQAVFNALAKIYIDSNNNPEK
FLKENDAYDTLTVGKYCEKRDPNLAYIAYSKGQNDLELVNITNENSMYRAQARYLLDRADNELWRFALSENNIHR
RSVVDQVISTAVPESTDPSKVSVAVASFLENDLPLELIELLEKIVLEPSPFSDNQNLQNLLMFTAAKADKGRVMD
YIHKLDNYIPDDIATSCIEVGLFEEAFEVYKKADNKTAAVNVLVEHVVSIDRSQAYAEEVDVPEVWSKVAKAQLD
GLRVSDSIESYIKAGDAKNYDEVIEIATHAGKNEDLVKYLRMARKTLREPSIDTALAFCYARLDQLPELEDFLRA
TNVANIDQCGDKAYEEGLFEASKIFYSSVSNWAKLATTLVHLGDYQAAVDCARKANNIKVWKQVHDACVEKKEFR
LAQICGLNLIVDAEQLDALVKEYERNGYFDELIDLLEQGLGLERVHMAMFTQLGIALSKYHPERLLEHIKLFWTR
INMPKMIRACEEANLWPELVFCYCHYDEFDNAALAVIERPENTWEHQQFKEIVVKVANLEIYYRAIKFYVEQHPS
LLTDLLTALTARIDVNRVVKMFKKNDSLPLIKPFLLNVQSQNKRIVNEAVNDLLIEEEDYKTLRDSVQNYDNYEA
VELASRLEKHDLIFFRQIAASIYRKNKRWEKSIALSKQDKLFKDAIETAATSGKSEIVEDLLRYFVDIGHRECYT
GMLYACNNLIRPDLVLELSWRHGLHDFSMPYMVNMLAQQTKEIALLKADNEARKAKEKEQEKTEDNTPILGGSRL
MITAGPGGGMGGGMGGGAPAGTFGQTNGFIPQPTGYGL*
Coding >OphauG2|3463
ATGGCGCCTTTGCCCATCAAATTCCAGGAGCAGGTGCAGCTCACCAATGTCGGCGTTGAGCCGCAGTCGATTGGC
TTCAACTCTTGCACGCTCGAGTCTGATTCCTTCGTTTGCATTCGAGAAAAGAAGAGCGACGCTGCGCAGCCCGAA
GTCGTCATTGTCGAGCTCAAGAATGGCAACAACGTCACTCGCCGGCCCATCAAGGCCGATAGTGCTATCATGCAC
TGGAGTAGACAGGTGATTGCACTCAAGGCTCAGTCACGCACCCTGCAAATTTTCGACCTTGAGGAAAAGAAGAAG
CTCAAGTCGTGCACCATGAATGAAGACGTTCAGTTCTGGAAATGGATCAGCCAAACTACTTTGGGGCTCGTTACT
ACCTCCAGCGTCTACCATTGGGACGTCTACGACTCATCTCAGGAAGCACCTGCCAAGGTGTTTGAACGCAACGCA
AACCTGACTGGATGCCAAATCATTAATTACCGCGCCAACGCCGACGGCAAATGGATGGTTCTTGTCGGCATCTCG
TCGCAGCAAAATCGCGTGGTTGGTGCCATGCAGCTCTACTCCAAAGACCGTGGCATTAGTCAGGCCATTGAGGGC
CATGCTGCTTGCTTTGGCTCCATCAGGTTAGAGGGGGCTCCTCAAGACACCAAGATATTTAGTTTCGCTGTCCGC
ACTGCTGTCGGGGCAAAGTTGCACATCGTCGAGGTGGACCATGCCGAGTCCAACCCGGTCTTTCAAAAGAAGGCC
GTGGACATGTTCTTTCCCGCCGAAGTACCAAACGACTTCCCCGTTGCACTCCAAATATCTCAAAAATACGGCATC
ATTTTCGTTGTGACCAAGTATGGCTTTGTTCACATTTACGACCTTGAATCTGGAACAACCATATTCATGAACCGC
ATCTCGTCGGAAACAATCTTCACCACTTGCGGAGACAGCGATTCCACTGGTCTTCTCGGCATCAATAGAAAGGGC
CAGGTTCTCTTTGTCACTATTGATGAATCCACCATTATTCCCTATCTCCTTGAGAATCCTCTTCATTCTGAGATA
GCCATTCGACTGGCTGCCAGAGCTGGGCTCCCAGGTGCAGACAGCCTATATGCGCAGCAGTTTGACCAGTTGTTC
AATTCTGGAAACTACCAAGAGGCTGCAAAAGTTGCCGCCAATTCGCCCCGAGGCTTCTTGCGCACTGCCGAAACC
ATTGACAAGTTCAAGAAGATCCCTTCACAGCCAGGCCAAATAACTGTTGCCCTGCAGTATTTTGGAATGCTTCTC
GACAAGGGCGGCCTGAACCGCCACGAGTCGCTTGAACTCGCTCAGCCGGTTTTGCAGCAGAACCGCAAACATCTG
CTGGAAAAATGGCTCAAGGAGGGAAAGCTGGACTGCTCGGAACAACTGGGCGATTTGGTACGGGTCCATGATGTC
AATATGGCGCTGTCCATTTACCTCAAGGCCAATGCCCCTCAAAAGGTTGTTGCTGGCTTTGCCGAGACGGGCCAA
TTTGACAAGATTTTGCCCTATGCCGCTCAAACCGGCTACCAGCCCGATTACATTCAGCTTCTTCAGCACATTATC
CGCACCAATCCCGAGAGGGGCGGCGAGTTTGCCTCGGCCCTAGCTAACAGCGACCAGGGCCCCTTGGTGGATTAT
GATCGTGTGTGCGATATCTTTCAATCTCAGGGCATGGTGCAGCAGGCCACGGCCTTCCTCCTTGATGCTCTCAAG
GAGAACAAGCCCGAGCATGCACGTCTGCAGACTCGTCTGCTTGAGATGAATTTGATGCACGCACCCCAAGTGGCC
GAGGCGATTCTCAGTAATGATATGTTCACTCACTTTGATCGCTCTCGAATTGCCCAGCTATGCGAACAAGCAGGG
CTGGCTCAAAAGGCCTTGGAGCTTTATGAAGACCCGGAATCCATCAAGCGAGTAATTGTCAACATTCCTGGCAAC
CCCAACTTTGATCCCGAGTTTTTGACAAACTTTTTTGGCAAATTATCAGTCGAACAATCACTCGACTGCCTGGAT
GCCATGATGAGGCACAATATTCGCCAGAATTTGTCCTCGGTTGTCGCCATTGCAACCAAGTACTCGGAACTTCTC
GGCCCTGTGCAATTGATTGACTTGTTTGAAAAGTACAAGACGGCCGAGGGTCTCTTTTACTATCTCGGCAGCATC
ATCAACATTTCCAACGACCCCGATGTGCACTACAAGTACATTGAGGCGGCTGCCCGGTCCAACCAGATCAACGAG
GTGGAGAGAATTTGCCGAGAAAGCCAATTCTACAATCCTGAAAAGGTCAAAAACTTTCTCAAGGAGGCACGCTTG
CCCGAATTGACGCCCCTCATTATTGTCTGCGACCGCTTCAATTTTGTCCACGAGCTTGTCCTCTATCTCTATCAG
CACCAGCACTTTGAAGCAATTGAAAAGTTTGTTCAGCTCATCAACCCAAGCAGAACACCTGCCGTTGTTGGCGGT
TTACTAGATGTTGATTGTGAAGAAAACATTATCAAGCAGCTCTTGTCCACGGTTGATCCCCAGAGAATCAATATT
GACGAGCTGGTGGCCGAGGTTGAATCCCGCAATCGCCTCAAGATTTTGTTGCCGTTTCTCGAGACCACTCTGCAG
GCTGGCAATCAACAGCAAGCAGTCTTCAATGCGCTCGCAAAGATTTATATTGACTCGAATAACAACCCTGAAAAG
TTCCTCAAGGAGAATGATGCATATGACACGCTGACAGTTGGCAAATACTGCGAGAAGCGAGACCCCAATCTCGCC
TACATTGCTTACTCCAAGGGCCAGAATGACTTGGAACTGGTCAATATTACCAATGAGAATTCAATGTATCGAGCA
CAGGCTCGATATCTCTTGGACCGTGCCGACAATGAACTATGGAGATTTGCCCTTAGCGAGAACAATATTCACCGT
CGCTCAGTCGTCGACCAGGTTATTTCCACGGCTGTCCCCGAGTCGACTGACCCGTCCAAGGTTTCTGTTGCTGTG
GCAAGCTTTCTCGAGAATGACTTGCCGCTTGAGCTTATTGAGCTTTTGGAAAAGATTGTTCTGGAGCCTTCGCCC
TTTTCAGACAACCAAAACCTGCAGAATCTCCTCATGTTCACGGCTGCCAAGGCTGACAAGGGCCGAGTCATGGAC
TATATTCACAAGCTGGACAATTATATTCCCGACGACATTGCCACGTCGTGTATCGAGGTTGGCCTCTTTGAGGAG
GCTTTTGAGGTTTACAAAAAGGCGGACAACAAGACGGCTGCAGTCAATGTCTTGGTTGAGCATGTTGTTAGCATT
GACCGCTCCCAGGCATATGCGGAGGAAGTGGACGTTCCAGAGGTTTGGAGCAAGGTGGCCAAGGCGCAGCTCGAT
GGCCTGCGCGTCTCGGACAGCATTGAGTCGTACATCAAGGCTGGCGACGCCAAGAACTATGACGAGGTGATTGAA
ATTGCCACGCACGCAGGCAAGAATGAGGACCTTGTCAAGTACCTGCGTATGGCTCGCAAGACGCTTCGCGAGCCT
TCGATTGACACTGCGCTCGCGTTTTGCTATGCCCGTCTTGATCAGTTGCCGGAGCTTGAAGACTTTTTGCGGGCT
ACCAATGTGGCCAATATTGACCAGTGTGGTGACAAGGCCTACGAAGAGGGTCTCTTTGAAGCCTCCAAGATTTTT
TACAGCAGCGTCTCCAACTGGGCCAAGCTGGCCACGACGCTTGTGCACCTGGGCGACTACCAGGCAGCCGTGGAC
TGTGCTCGCAAAGCCAACAATATCAAGGTGTGGAAGCAGGTGCATGATGCCTGCGTCGAAAAGAAGGAATTCCGT
TTGGCGCAGATTTGTGGTCTCAACCTTATTGTCGATGCCGAGCAATTGGACGCACTCGTCAAGGAGTATGAGCGA
AACGGCTACTTTGACGAGCTTATTGATCTTTTGGAACAAGGCTTGGGGCTTGAGCGTGTCCACATGGCCATGTTT
ACGCAGCTTGGAATTGCGCTCTCCAAGTACCACCCAGAGCGGCTACTGGAGCACATCAAGCTCTTTTGGACTCGG
ATCAACATGCCAAAGATGATTCGAGCTTGCGAGGAAGCCAACCTTTGGCCTGAGCTCGTCTTCTGTTACTGCCAC
TATGACGAATTCGACAATGCTGCTCTTGCAGTGATTGAGCGTCCCGAGAACACGTGGGAGCATCAGCAGTTCAAG
GAAATCGTGGTCAAGGTGGCCAATTTGGAGATATACTATCGTGCCATCAAGTTTTATGTGGAGCAGCATCCATCT
CTGCTGACGGATCTGTTGACTGCTCTGACTGCGCGCATCGACGTTAATCGAGTGGTCAAGATGTTCAAGAAGAAT
GACAGCTTGCCTCTGATTAAGCCATTTCTTCTCAATGTGCAGTCTCAAAACAAGCGCATTGTCAATGAGGCGGTG
AATGATCTCTTGATTGAGGAGGAGGACTACAAGACTCTCCGCGACTCTGTCCAGAATTACGACAATTACGAGGCT
GTCGAGCTGGCTAGTCGACTGGAGAAGCATGACCTCATCTTTTTCCGACAGATTGCCGCCAGCATCTACCGCAAG
AATAAGCGATGGGAAAAGTCAATCGCCTTGTCCAAACAAGACAAACTATTCAAGGACGCCATTGAGACTGCCGCC
ACATCTGGAAAGAGCGAGATTGTCGAAGACTTGTTGCGCTACTTTGTGGACATTGGGCACCGAGAATGCTATACT
GGCATGCTGTATGCATGCAACAACCTTATTAGGCCCGACCTGGTGCTGGAGTTGTCGTGGCGCCACGGGCTTCAT
GACTTTTCGATGCCGTATATGGTCAATATGCTGGCACAGCAAACCAAGGAGATTGCCCTCCTCAAGGCAGACAAC
GAAGCTCGCAAGGCCAAGGAAAAGGAGCAGGAAAAGACTGAGGACAATACGCCGATTTTGGGTGGTTCTCGTCTC
ATGATTACAGCCGGGCCTGGGGGCGGTATGGGCGGTGGTATGGGCGGCGGTGCACCAGCTGGCACGTTTGGACAG
ACCAACGGATTCATACCGCAACCCACCGGCTACGGACTCTAG
Transcript >OphauG2|3463
ATGGCGCCTTTGCCCATCAAATTCCAGGAGCAGGTGCAGCTCACCAATGTCGGCGTTGAGCCGCAGTCGATTGGC
TTCAACTCTTGCACGCTCGAGTCTGATTCCTTCGTTTGCATTCGAGAAAAGAAGAGCGACGCTGCGCAGCCCGAA
GTCGTCATTGTCGAGCTCAAGAATGGCAACAACGTCACTCGCCGGCCCATCAAGGCCGATAGTGCTATCATGCAC
TGGAGTAGACAGGTGATTGCACTCAAGGCTCAGTCACGCACCCTGCAAATTTTCGACCTTGAGGAAAAGAAGAAG
CTCAAGTCGTGCACCATGAATGAAGACGTTCAGTTCTGGAAATGGATCAGCCAAACTACTTTGGGGCTCGTTACT
ACCTCCAGCGTCTACCATTGGGACGTCTACGACTCATCTCAGGAAGCACCTGCCAAGGTGTTTGAACGCAACGCA
AACCTGACTGGATGCCAAATCATTAATTACCGCGCCAACGCCGACGGCAAATGGATGGTTCTTGTCGGCATCTCG
TCGCAGCAAAATCGCGTGGTTGGTGCCATGCAGCTCTACTCCAAAGACCGTGGCATTAGTCAGGCCATTGAGGGC
CATGCTGCTTGCTTTGGCTCCATCAGGTTAGAGGGGGCTCCTCAAGACACCAAGATATTTAGTTTCGCTGTCCGC
ACTGCTGTCGGGGCAAAGTTGCACATCGTCGAGGTGGACCATGCCGAGTCCAACCCGGTCTTTCAAAAGAAGGCC
GTGGACATGTTCTTTCCCGCCGAAGTACCAAACGACTTCCCCGTTGCACTCCAAATATCTCAAAAATACGGCATC
ATTTTCGTTGTGACCAAGTATGGCTTTGTTCACATTTACGACCTTGAATCTGGAACAACCATATTCATGAACCGC
ATCTCGTCGGAAACAATCTTCACCACTTGCGGAGACAGCGATTCCACTGGTCTTCTCGGCATCAATAGAAAGGGC
CAGGTTCTCTTTGTCACTATTGATGAATCCACCATTATTCCCTATCTCCTTGAGAATCCTCTTCATTCTGAGATA
GCCATTCGACTGGCTGCCAGAGCTGGGCTCCCAGGTGCAGACAGCCTATATGCGCAGCAGTTTGACCAGTTGTTC
AATTCTGGAAACTACCAAGAGGCTGCAAAAGTTGCCGCCAATTCGCCCCGAGGCTTCTTGCGCACTGCCGAAACC
ATTGACAAGTTCAAGAAGATCCCTTCACAGCCAGGCCAAATAACTGTTGCCCTGCAGTATTTTGGAATGCTTCTC
GACAAGGGCGGCCTGAACCGCCACGAGTCGCTTGAACTCGCTCAGCCGGTTTTGCAGCAGAACCGCAAACATCTG
CTGGAAAAATGGCTCAAGGAGGGAAAGCTGGACTGCTCGGAACAACTGGGCGATTTGGTACGGGTCCATGATGTC
AATATGGCGCTGTCCATTTACCTCAAGGCCAATGCCCCTCAAAAGGTTGTTGCTGGCTTTGCCGAGACGGGCCAA
TTTGACAAGATTTTGCCCTATGCCGCTCAAACCGGCTACCAGCCCGATTACATTCAGCTTCTTCAGCACATTATC
CGCACCAATCCCGAGAGGGGCGGCGAGTTTGCCTCGGCCCTAGCTAACAGCGACCAGGGCCCCTTGGTGGATTAT
GATCGTGTGTGCGATATCTTTCAATCTCAGGGCATGGTGCAGCAGGCCACGGCCTTCCTCCTTGATGCTCTCAAG
GAGAACAAGCCCGAGCATGCACGTCTGCAGACTCGTCTGCTTGAGATGAATTTGATGCACGCACCCCAAGTGGCC
GAGGCGATTCTCAGTAATGATATGTTCACTCACTTTGATCGCTCTCGAATTGCCCAGCTATGCGAACAAGCAGGG
CTGGCTCAAAAGGCCTTGGAGCTTTATGAAGACCCGGAATCCATCAAGCGAGTAATTGTCAACATTCCTGGCAAC
CCCAACTTTGATCCCGAGTTTTTGACAAACTTTTTTGGCAAATTATCAGTCGAACAATCACTCGACTGCCTGGAT
GCCATGATGAGGCACAATATTCGCCAGAATTTGTCCTCGGTTGTCGCCATTGCAACCAAGTACTCGGAACTTCTC
GGCCCTGTGCAATTGATTGACTTGTTTGAAAAGTACAAGACGGCCGAGGGTCTCTTTTACTATCTCGGCAGCATC
ATCAACATTTCCAACGACCCCGATGTGCACTACAAGTACATTGAGGCGGCTGCCCGGTCCAACCAGATCAACGAG
GTGGAGAGAATTTGCCGAGAAAGCCAATTCTACAATCCTGAAAAGGTCAAAAACTTTCTCAAGGAGGCACGCTTG
CCCGAATTGACGCCCCTCATTATTGTCTGCGACCGCTTCAATTTTGTCCACGAGCTTGTCCTCTATCTCTATCAG
CACCAGCACTTTGAAGCAATTGAAAAGTTTGTTCAGCTCATCAACCCAAGCAGAACACCTGCCGTTGTTGGCGGT
TTACTAGATGTTGATTGTGAAGAAAACATTATCAAGCAGCTCTTGTCCACGGTTGATCCCCAGAGAATCAATATT
GACGAGCTGGTGGCCGAGGTTGAATCCCGCAATCGCCTCAAGATTTTGTTGCCGTTTCTCGAGACCACTCTGCAG
GCTGGCAATCAACAGCAAGCAGTCTTCAATGCGCTCGCAAAGATTTATATTGACTCGAATAACAACCCTGAAAAG
TTCCTCAAGGAGAATGATGCATATGACACGCTGACAGTTGGCAAATACTGCGAGAAGCGAGACCCCAATCTCGCC
TACATTGCTTACTCCAAGGGCCAGAATGACTTGGAACTGGTCAATATTACCAATGAGAATTCAATGTATCGAGCA
CAGGCTCGATATCTCTTGGACCGTGCCGACAATGAACTATGGAGATTTGCCCTTAGCGAGAACAATATTCACCGT
CGCTCAGTCGTCGACCAGGTTATTTCCACGGCTGTCCCCGAGTCGACTGACCCGTCCAAGGTTTCTGTTGCTGTG
GCAAGCTTTCTCGAGAATGACTTGCCGCTTGAGCTTATTGAGCTTTTGGAAAAGATTGTTCTGGAGCCTTCGCCC
TTTTCAGACAACCAAAACCTGCAGAATCTCCTCATGTTCACGGCTGCCAAGGCTGACAAGGGCCGAGTCATGGAC
TATATTCACAAGCTGGACAATTATATTCCCGACGACATTGCCACGTCGTGTATCGAGGTTGGCCTCTTTGAGGAG
GCTTTTGAGGTTTACAAAAAGGCGGACAACAAGACGGCTGCAGTCAATGTCTTGGTTGAGCATGTTGTTAGCATT
GACCGCTCCCAGGCATATGCGGAGGAAGTGGACGTTCCAGAGGTTTGGAGCAAGGTGGCCAAGGCGCAGCTCGAT
GGCCTGCGCGTCTCGGACAGCATTGAGTCGTACATCAAGGCTGGCGACGCCAAGAACTATGACGAGGTGATTGAA
ATTGCCACGCACGCAGGCAAGAATGAGGACCTTGTCAAGTACCTGCGTATGGCTCGCAAGACGCTTCGCGAGCCT
TCGATTGACACTGCGCTCGCGTTTTGCTATGCCCGTCTTGATCAGTTGCCGGAGCTTGAAGACTTTTTGCGGGCT
ACCAATGTGGCCAATATTGACCAGTGTGGTGACAAGGCCTACGAAGAGGGTCTCTTTGAAGCCTCCAAGATTTTT
TACAGCAGCGTCTCCAACTGGGCCAAGCTGGCCACGACGCTTGTGCACCTGGGCGACTACCAGGCAGCCGTGGAC
TGTGCTCGCAAAGCCAACAATATCAAGGTGTGGAAGCAGGTGCATGATGCCTGCGTCGAAAAGAAGGAATTCCGT
TTGGCGCAGATTTGTGGTCTCAACCTTATTGTCGATGCCGAGCAATTGGACGCACTCGTCAAGGAGTATGAGCGA
AACGGCTACTTTGACGAGCTTATTGATCTTTTGGAACAAGGCTTGGGGCTTGAGCGTGTCCACATGGCCATGTTT
ACGCAGCTTGGAATTGCGCTCTCCAAGTACCACCCAGAGCGGCTACTGGAGCACATCAAGCTCTTTTGGACTCGG
ATCAACATGCCAAAGATGATTCGAGCTTGCGAGGAAGCCAACCTTTGGCCTGAGCTCGTCTTCTGTTACTGCCAC
TATGACGAATTCGACAATGCTGCTCTTGCAGTGATTGAGCGTCCCGAGAACACGTGGGAGCATCAGCAGTTCAAG
GAAATCGTGGTCAAGGTGGCCAATTTGGAGATATACTATCGTGCCATCAAGTTTTATGTGGAGCAGCATCCATCT
CTGCTGACGGATCTGTTGACTGCTCTGACTGCGCGCATCGACGTTAATCGAGTGGTCAAGATGTTCAAGAAGAAT
GACAGCTTGCCTCTGATTAAGCCATTTCTTCTCAATGTGCAGTCTCAAAACAAGCGCATTGTCAATGAGGCGGTG
AATGATCTCTTGATTGAGGAGGAGGACTACAAGACTCTCCGCGACTCTGTCCAGAATTACGACAATTACGAGGCT
GTCGAGCTGGCTAGTCGACTGGAGAAGCATGACCTCATCTTTTTCCGACAGATTGCCGCCAGCATCTACCGCAAG
AATAAGCGATGGGAAAAGTCAATCGCCTTGTCCAAACAAGACAAACTATTCAAGGACGCCATTGAGACTGCCGCC
ACATCTGGAAAGAGCGAGATTGTCGAAGACTTGTTGCGCTACTTTGTGGACATTGGGCACCGAGAATGCTATACT
GGCATGCTGTATGCATGCAACAACCTTATTAGGCCCGACCTGGTGCTGGAGTTGTCGTGGCGCCACGGGCTTCAT
GACTTTTCGATGCCGTATATGGTCAATATGCTGGCACAGCAAACCAAGGAGATTGCCCTCCTCAAGGCAGACAAC
GAAGCTCGCAAGGCCAAGGAAAAGGAGCAGGAAAAGACTGAGGACAATACGCCGATTTTGGGTGGTTCTCGTCTC
ATGATTACAGCCGGGCCTGGGGGCGGTATGGGCGGTGGTATGGGCGGCGGTGCACCAGCTGGCACGTTTGGACAG
ACCAACGGATTCATACCGCAACCCACCGGCTACGGACTCTAG
Gene >OphauG2|3463
ATGGCGCCTTTGCCCATCAAATTCCAGGAGCAGGTGCAGCTCACCAATGTCGGCGTTGAGCCGCAGTCGATTGGC
TTCAACTCTTGCGTAAGTCTTTTGCCTCGTCTTGCTTTGCCCCGCCGTGACGACTGGTGGCTGACACTTGCTCTG
CCAGACGCTCGAGTCTGATTCCTTCGTTTGCATTCGAGAAAAGAAGAGCGACGCTGCGCAGCCCGAAGTCGTCAT
TGTCGAGCTCAAGAATGGCAACAACGTCACTCGCCGGCCCATCAAGGCCGATAGTGCTATCATGCACTGGAGTAG
ACAGGTGATTGCACTCAAGGCTCAGTCACGCACCCTGCAAATTTTCGACCTTGAGGAAAAGAAGAAGCTCAAGTC
GTGCACCATGAATGAAGACGTTCAGTTCTGGAAATGGATCAGCCAAACTACTTTGGGGCTCGTTACTACCTCCAG
CGTCTACCATTGGGACGTCTACGACTCATCTCAGGAAGCACCTGCCAAGGTGTTTGAACGCAACGCAAACCTGAC
TGTACGTCTCAAGACTTGCCCGCCCCATCTAACCCTTTTCAAGCTAACCATTGTTCTTTTTTTTTTTGTTTCTCA
GGGATGCCAAATCATTAATTACCGCGCCAACGCCGACGGCAAATGGATGGTTCTTGTCGGCATCTCGTCGCAGCA
AAATCGCGTGGTTGGTGCCATGCAGCTCTACTCCAAAGACCGTGGCATTAGTCAGGCCATTGAGGGCCATGCTGC
TTGCTTTGGCTCCATCAGGTTAGAGGGGGCTCCTCAAGACACCAAGATATTTAGTTTCGCTGTCCGCACTGCTGT
CGGGGCAAAGTTGCACATCGTCGAGGTGGACCATGCCGAGTCCAACCCGGTCTTTCAAAAGAAGGCCGTGGACAT
GTTCTTTCCCGCCGAAGTACCAAACGACTTCCCCGTTGCACTCCAAATATCTCAAAAATACGGCATCATTTTCGT
TGTGACCAAGTATGGCTTTGTTCACATTTACGACCTTGAATCTGGAACAACCATATTCATGAACCGCATCTCGTC
GGAAACAATCTTCACCACTTGCGGAGACAGCGATTCCACTGGTCTTCTCGGCATCAATAGAAAGGGCCAGGTTCT
CTTTGTCACTATTGATGAATCCACCATTATTCCCTATCTCCTTGAGAATCCTCTTCATTCTGAGATAGCCATTCG
ACTGGCTGCCAGAGCTGGGCTCCCAGGTGCAGACAGCCTATATGCGCAGCAGTTTGACCAGTTGTTCAATTCTGG
AAACTACCAAGAGGCTGCAAAAGTTGCCGCCAATTCGCCCCGAGGCTTCTTGCGCACTGCCGAAACCATTGACAA
GTTCAAGAAGATCCCTTCACAGCCAGGCCAAATAACTGTTGCCCTGCAGTATTTTGGAATGCTTCTCGACAAGGG
CGGCCTGAACCGCCACGAGTCGCTTGAACTCGCTCAGCCGGTTTTGCAGCAGAACCGCAAACATCTGCTGGAAAA
ATGGCTCAAGGAGGGAAAGCTGGACTGCTCGGAACAACTGGGCGATTTGGTACGGGTCCATGATGTCAATATGGC
GCTGTCCATTTACCTCAAGGCCAATGCCCCTCAAAAGGTTGTTGCTGGCTTTGCCGAGACGGGCCAATTTGACAA
GATTTTGCCCTATGCCGCTCAAACCGGCTACCAGCCCGATTACATTCAGCTTCTTCAGCACATTATCCGCACCAA
TCCCGAGAGGGGCGGCGAGTTTGCCTCGGCCCTAGCTAACAGCGACCAGGGCCCCTTGGTGGATTATGATCGTGT
GTGCGATATCTTTCAATCTCAGGGCATGGTGCAGCAGGCCACGGCCTTCCTCCTTGATGCTCTCAAGGAGAACAA
GCCCGAGCATGCACGTCTGCAGACTCGTCTGCTTGAGATGAATTTGATGCACGCACCCCAAGTGGCCGAGGCGAT
TCTCAGTAATGATATGTTCACTCACTTTGATCGCTCTCGAATTGCCCAGCTATGCGAACAAGCAGGGCTGGCTCA
AAAGGCCTTGGAGCTTTATGAAGACCCGGAATCCATCAAGCGAGTAATTGTCAACATTCCTGGCAACCCCAACTT
TGATCCCGAGTTTTTGACAAACTTTTTTGGCAAATTATCAGTCGAACAATCACTCGACTGCCTGGATGCCATGAT
GAGGCACAATATTCGCCAGAATTTGTCCTCGGTTGTCGCCATTGCAACCAAGTACTCGGAACTTCTCGGCCCTGT
GCAATTGATTGACTTGTTTGAAAAGTACAAGACGGCCGAGGGTCTCTTTTACTATCTCGGCAGCATCATCAACAT
TTCCAACGACCCCGATGTGCACTACAAGTACATTGAGGCGGCTGCCCGGTCCAACCAGATCAACGAGGTGGAGAG
AATTTGCCGAGAAAGCCAATTCTACAATCCTGAAAAGGTCAAAAACTTTCTCAAGGAGGCACGCTTGCCCGAATT
GACGCCCCTCATTATTGTCTGCGACCGCTTCAATTTTGTCCACGAGCTTGTCCTCTATCTCTATCAGCACCAGCA
CTTTGAAGCAATTGAAAAGTTTGTTCAGCTCATCAACCCAAGCAGAACACCTGCCGTTGTTGGCGGTTTACTAGA
TGTTGATTGTGAAGAAAACATTATCAAGCAGCTCTTGTCCACGGTTGATCCCCAGAGAATCAATATTGACGAGCT
GGTGGCCGAGGTTGAATCCCGCAATCGCCTCAAGATTTTGTTGCCGTTTCTCGAGACCACTCTGCAGGCTGGCAA
TCAACAGCAAGCAGTCTTCAATGCGCTCGCAAAGATTTATATTGACTCGAATAACAACCCTGAAAAGTTCCTCAA
GGAGAATGATGCATATGACACGCTGACAGTTGGCAAATACTGCGAGAAGCGAGACCCCAATCTCGCCTACATTGC
TTACTCCAAGGGCCAGAATGACTTGGAACTGGTCAATATTACCAATGAGAATTCAATGTATCGAGCACAGGCTCG
ATATCTCTTGGACCGTGCCGACAATGAACTATGGAGATTTGCCCTTAGCGAGAACAATATTCACCGTCGCTCAGT
CGTCGACCAGGTTATTTCCACGGCTGTCCCCGAGTCGACTGACCCGTCCAAGGTTTCTGTTGCTGTGGCAAGCTT
TCTCGAGAATGACTTGCCGCTTGAGCTTATTGAGCTTTTGGAAAAGATTGTTCTGGAGCCTTCGCCCTTTTCAGA
CAACCAAAACCTGCAGAATCTCCTCATGTTCACGGCTGCCAAGGCTGACAAGGGCCGAGTCATGGACTATATTCA
CAAGCTGGACAATTATATTCCCGACGACATTGCCACGTCGTGTATCGAGGTTGGCCTCTTTGAGGAGGCTTTTGA
GGTTTACAAAAAGGCGGACAACAAGACGGCTGCAGTCAATGTCTTGGTTGAGCATGTTGTTAGCATTGACCGCTC
CCAGGCATATGCGGAGGAAGTGGACGTTCCAGAGGTTTGGAGCAAGGTGGCCAAGGCGCAGCTCGATGGCCTGCG
CGTCTCGGACAGCATTGAGTCGTACATCAAGGCTGGCGACGCCAAGAACTATGACGAGGTGATTGAAATTGCCAC
GCACGCAGGCAAGAATGAGGACCTTGTCAAGTACCTGCGTATGGCTCGCAAGACGCTTCGCGAGCCTTCGATTGA
CACTGCGCTCGCGTTTTGCTATGCCCGTCTTGATCAGTTGCCGGAGCTTGAAGACTTTTTGCGGGCTACCAATGT
GGCCAATATTGACCAGTGTGGTGACAAGGCCTACGAAGAGGGTCTCTTTGAAGCCTCCAAGATTTTTTACAGCAG
CGTCTCCAACTGGGCCAAGCTGGCCACGACGCTTGTGCACCTGGGCGACTACCAGGCAGCCGTGGACTGTGCTCG
CAAAGCCAACAATATCAAGGTGTGGAAGCAGGTGCATGATGCCTGCGTCGAAAAGAAGGAATTCCGTTTGGCGCA
GATTTGTGGTCTCAACCTTATTGTCGATGCCGAGCAATTGGACGCACTCGTCAAGGAGTATGAGCGAAACGGCTA
CTTTGACGAGCTTATTGATCTTTTGGAACAAGGCTTGGGGCTTGAGCGTGTCCACATGGCCATGTTTACGCAGCT
TGGAATTGCGCTCTCCAAGTACCACCCAGAGCGGCTACTGGAGCACATCAAGCTCTTTTGGACTCGGATCAACAT
GCCAAAGATGATTCGAGCTTGCGAGGAAGCCAACCTTTGGCCTGAGCTCGTCTTCTGTTACTGCCACTATGACGA
ATTCGACAATGCTGCTCTTGCAGTGATTGAGCGTCCCGAGAACACGTGGGAGCATCAGCAGTTCAAGGAAATCGT
GGTCAAGGTGGCCAATTTGGAGATATACTATCGTGCCATCAAGTTTTATGTGGAGCAGCATCCATCTCTGCTGAC
GGATCTGTTGACTGCTCTGACTGCGCGCATCGACGTTAATCGAGTGGTCAAGATGTTCAAGAAGAATGACAGCTT
GCCTCTGATTAAGCCATTTCTTCTCAATGTGCAGTCTCAAAACAAGCGCATTGTCAATGAGGCGGTGAATGATCT
CTTGATTGAGGAGGAGGACTACAAGACTCTCCGCGACTCTGTCCAGAATTACGACAATTACGAGGCTGTCGAGCT
GGCTAGTCGACTGGAGAAGCATGACCTCATCTTTTTCCGACAGATTGCCGCCAGCATCTACCGCAAGAATAAGCG
ATGGGAAAAGTCAATCGCCTTGTCCAAACAAGACAAACTATTCAAGGACGCCATTGAGACTGCCGCCACATCTGG
AAAGAGCGAGATTGTCGAAGACTTGTTGCGCTACGTGAGTACTGTACAATTTTTTTTTCAAGTTCTTTCAAGTTT
TTTTTTTTTTTTTGCTGCTGTCGTTGCAAAAGGCTAACTTTATCTGTTTTTTCCCCTCTTAGTTTGTGGACATTG
GGCACCGAGAATGCTATACTGGCATGCTGTATGCATGCAACAACCTTATTAGGCCCGACCTGGTGCTGGAGTTGT
CGTGGCGCCACGGGCTTCATGACTTTTCGATGCCGTATATGGTCAATATGCTGGCACAGCAAACCAAGGAGATTG
CCCTCCTCAAGGCAGACAACGAAGCTCGCAAGGCCAAGGAAAAGGAGCAGGAAAAGACTGAGGACAATACGCCGA
TTTTGGGTGGTTCTCGTCTCATGATTACAGCCGGGCCTGGGGGCGGTATGGGCGGTGGTATGGGCGGCGGTGCAC
CAGCTGGCACGTTTGGACAGACCAACGGATTCATACCGCAACCCACCGGCTACGGACTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail