Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3449
Gene name
LocationContig_260:16858..19236
Strand+
Gene length (bp)2378
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08167 RIX1 rRNA processing/ribosome biogenesis 1.1E-57 9 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87243|RIX1_SCHPO Pre-rRNA-processing protein rix1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rix1 PE=1 SV=1 66 397 7.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3449 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6880
Ophiocordyceps camponoti-floridani Ophcf2|07093
Ophiocordyceps camponoti-rufipedis Ophun1|7058
Ophiocordyceps kimflemingae Ophio5|5325
Ophiocordyceps subramaniannii Hirsu2|6510

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3449
MASQPPPDLGVLCTKLSSTPAIQLPHALPVLTRHVVRCKDALSAPQEQKLKDNASQSSLLIHKIKTQIITLLNGR
SREGRFAAVGLVKAVIDVGGWEMLRGSEPWVRGLLSIMQKGDSFACKELAVVTLTRIYMLLHPYPTLAREIATAT
LPAFITASLQIVKSDGSVPLAAPCSIVMGVCEAFAALIPLYPTTFRPHASQIRSSIRLYLAPTTSDAVFVPPSLQ
RAAGRLTVTLHHVAAKSGGSDEWAKLMDGFLRDLHLTADQVFRAVDESWEAKGNFQRAAVALDGVPNGGGVSADQ
LPTWQGLSAGAQRIMGLLGLVSDALCCQTKGAVEIPLGAIMTAVSRICSIARLSPKAQSWHQAVETNPAIGRDER
DELWSVMPDLHVGAMEVVLVMLRRLQQSMLPLVQELSDHVVRVFKSGMDVAAVRKTGYLVLANLLSLAGPTLPKQ
SVAMVELLVIACCRDLQHNASLSVNSPSMPATDTKANAMANADLFLQPSSAPSPGLATTKLDLDHAAAATNLLPV
LLSHLPQQHIKPSLRGLVDRTAILTRNRDAMLASVLNPYRDSSGRMLPSILPHLSRQFPHDQALEVLRCNMRTSS
AVGNGSHATLAEVPNHGISDETSRSHVASADVENEHDSKTEDSDDRIKVETELVTSDVNTKPAAILAPPPLKANL
ALQSSAFIPRALSTTDTSLTDSQPKRKHPGSDASPAKRQEREKPAPVMKAPQREHLAADEDDSDESAHLNMELDE
DDDEEDDDDDDEKSGQEGQ*
Coding >OphauG2|3449
ATGGCATCACAGCCTCCCCCCGACCTCGGAGTCCTCTGCACGAAGCTCTCCTCGACACCTGCCATCCAGCTTCCG
CATGCTCTTCCTGTCCTGACGCGGCACGTGGTGCGCTGCAAAGATGCGCTGTCAGCGCCCCAGGAACAAAAACTC
AAAGACAATGCCTCGCAGAGCTCGCTGCTCATTCATAAAATCAAGACCCAAATCATCACGCTCTTGAATGGGCGC
AGCCGTGAGGGTAGGTTCGCTGCCGTGGGCTTGGTCAAGGCCGTGATTGATGTCGGAGGCTGGGAAATGCTTCGC
GGCTCCGAGCCTTGGGTTCGCGGTCTTTTGTCCATCATGCAGAAAGGAGACTCGTTTGCTTGCAAAGAATTGGCC
GTCGTGACTCTGACTCGCATTTACATGCTGCTTCATCCTTATCCAACACTGGCGAGGGAAATAGCAACGGCTACG
CTCCCCGCATTCATCACGGCCAGTCTCCAAATAGTCAAGTCTGATGGCTCTGTACCTCTAGCAGCTCCTTGCTCA
ATTGTCATGGGGGTATGCGAGGCCTTTGCAGCTTTGATACCACTCTACCCGACAACCTTTCGTCCGCATGCCTCT
CAGATCCGGTCATCCATAAGACTATACCTTGCGCCGACGACTTCGGATGCAGTCTTTGTTCCCCCATCTCTACAG
CGTGCTGCAGGCCGATTGACCGTTACTCTCCATCACGTCGCTGCAAAGTCGGGTGGAAGCGATGAATGGGCCAAG
CTCATGGACGGCTTCTTGCGCGACCTTCACCTGACGGCTGACCAAGTCTTTCGCGCCGTCGACGAGTCCTGGGAA
GCAAAAGGCAACTTTCAGCGGGCCGCCGTGGCTCTGGATGGAGTCCCAAACGGGGGAGGCGTCTCAGCAGACCAA
TTGCCTACTTGGCAAGGGCTGAGCGCCGGTGCTCAGCGCATCATGGGACTGCTGGGTCTCGTGTCGGACGCTTTG
TGCTGCCAAACTAAAGGAGCTGTTGAAATTCCTCTGGGAGCCATAATGACTGCAGTTTCTCGCATCTGCTCCATA
GCCCGACTTTCGCCAAAGGCTCAAAGCTGGCACCAGGCTGTCGAGACAAACCCTGCCATAGGCAGAGACGAGAGG
GACGAGCTCTGGAGTGTCATGCCCGACCTCCACGTGGGAGCCATGGAAGTAGTCCTGGTGATGCTGCGCAGACTC
CAACAGAGCATGCTCCCTCTGGTCCAGGAGCTGTCAGACCATGTCGTCCGCGTCTTCAAGTCGGGCATGGACGTT
GCAGCAGTCCGCAAAACTGGCTATCTTGTTCTCGCCAACCTTTTATCCCTGGCCGGGCCAACGCTGCCGAAGCAA
TCCGTGGCCATGGTAGAGCTCCTCGTCATCGCCTGCTGTCGCGACCTGCAGCACAACGCGTCTCTCAGCGTCAAT
TCGCCGTCGATGCCAGCCACAGATACCAAGGCCAATGCCATGGCCAACGCCGACCTCTTTCTACAACCATCCTCA
GCTCCATCCCCAGGACTGGCAACCACCAAGCTTGACCTGGATCACGCCGCCGCTGCTACTAATCTCCTGCCTGTA
CTGCTGTCCCATCTCCCGCAACAACACATCAAGCCCTCGCTTCGTGGCCTCGTGGACAGAACGGCCATTCTTACG
CGGAACCGTGACGCTATGCTCGCCAGCGTGCTAAATCCTTATCGCGACAGCAGCGGGCGCATGTTGCCTTCGATT
CTGCCTCATCTCTCGCGTCAGTTTCCTCACGACCAGGCACTCGAAGTACTGCGTTGCAACATGCGCACCTCGTCT
GCGGTAGGCAATGGCTCGCATGCGACACTGGCCGAGGTGCCCAACCATGGCATCAGCGATGAGACGAGCCGTAGT
CATGTTGCCAGTGCCGACGTGGAAAACGAACATGACTCGAAAACTGAAGACAGCGATGACAGAATCAAGGTTGAA
ACCGAACTTGTCACTAGTGATGTCAACACCAAGCCTGCTGCTATACTCGCGCCTCCTCCCCTCAAAGCCAACCTC
GCATTACAGAGCAGTGCCTTTATCCCTAGAGCTTTATCAACCACTGACACTTCATTGACTGATTCCCAACCCAAG
CGCAAGCACCCTGGCTCAGATGCTTCTCCGGCAAAGCGACAGGAAAGAGAAAAACCTGCACCAGTAATGAAAGCT
CCTCAACGGGAACACCTGGCAGCCGATGAGGACGACAGTGACGAGAGCGCGCACCTCAATATGGAACTAGACGAG
GATGACGACGAGGAGGATGACGACGACGACGACGAGAAAAGCGGTCAAGAGGGCCAATAG
Transcript >OphauG2|3449
ATGGCATCACAGCCTCCCCCCGACCTCGGAGTCCTCTGCACGAAGCTCTCCTCGACACCTGCCATCCAGCTTCCG
CATGCTCTTCCTGTCCTGACGCGGCACGTGGTGCGCTGCAAAGATGCGCTGTCAGCGCCCCAGGAACAAAAACTC
AAAGACAATGCCTCGCAGAGCTCGCTGCTCATTCATAAAATCAAGACCCAAATCATCACGCTCTTGAATGGGCGC
AGCCGTGAGGGTAGGTTCGCTGCCGTGGGCTTGGTCAAGGCCGTGATTGATGTCGGAGGCTGGGAAATGCTTCGC
GGCTCCGAGCCTTGGGTTCGCGGTCTTTTGTCCATCATGCAGAAAGGAGACTCGTTTGCTTGCAAAGAATTGGCC
GTCGTGACTCTGACTCGCATTTACATGCTGCTTCATCCTTATCCAACACTGGCGAGGGAAATAGCAACGGCTACG
CTCCCCGCATTCATCACGGCCAGTCTCCAAATAGTCAAGTCTGATGGCTCTGTACCTCTAGCAGCTCCTTGCTCA
ATTGTCATGGGGGTATGCGAGGCCTTTGCAGCTTTGATACCACTCTACCCGACAACCTTTCGTCCGCATGCCTCT
CAGATCCGGTCATCCATAAGACTATACCTTGCGCCGACGACTTCGGATGCAGTCTTTGTTCCCCCATCTCTACAG
CGTGCTGCAGGCCGATTGACCGTTACTCTCCATCACGTCGCTGCAAAGTCGGGTGGAAGCGATGAATGGGCCAAG
CTCATGGACGGCTTCTTGCGCGACCTTCACCTGACGGCTGACCAAGTCTTTCGCGCCGTCGACGAGTCCTGGGAA
GCAAAAGGCAACTTTCAGCGGGCCGCCGTGGCTCTGGATGGAGTCCCAAACGGGGGAGGCGTCTCAGCAGACCAA
TTGCCTACTTGGCAAGGGCTGAGCGCCGGTGCTCAGCGCATCATGGGACTGCTGGGTCTCGTGTCGGACGCTTTG
TGCTGCCAAACTAAAGGAGCTGTTGAAATTCCTCTGGGAGCCATAATGACTGCAGTTTCTCGCATCTGCTCCATA
GCCCGACTTTCGCCAAAGGCTCAAAGCTGGCACCAGGCTGTCGAGACAAACCCTGCCATAGGCAGAGACGAGAGG
GACGAGCTCTGGAGTGTCATGCCCGACCTCCACGTGGGAGCCATGGAAGTAGTCCTGGTGATGCTGCGCAGACTC
CAACAGAGCATGCTCCCTCTGGTCCAGGAGCTGTCAGACCATGTCGTCCGCGTCTTCAAGTCGGGCATGGACGTT
GCAGCAGTCCGCAAAACTGGCTATCTTGTTCTCGCCAACCTTTTATCCCTGGCCGGGCCAACGCTGCCGAAGCAA
TCCGTGGCCATGGTAGAGCTCCTCGTCATCGCCTGCTGTCGCGACCTGCAGCACAACGCGTCTCTCAGCGTCAAT
TCGCCGTCGATGCCAGCCACAGATACCAAGGCCAATGCCATGGCCAACGCCGACCTCTTTCTACAACCATCCTCA
GCTCCATCCCCAGGACTGGCAACCACCAAGCTTGACCTGGATCACGCCGCCGCTGCTACTAATCTCCTGCCTGTA
CTGCTGTCCCATCTCCCGCAACAACACATCAAGCCCTCGCTTCGTGGCCTCGTGGACAGAACGGCCATTCTTACG
CGGAACCGTGACGCTATGCTCGCCAGCGTGCTAAATCCTTATCGCGACAGCAGCGGGCGCATGTTGCCTTCGATT
CTGCCTCATCTCTCGCGTCAGTTTCCTCACGACCAGGCACTCGAAGTACTGCGTTGCAACATGCGCACCTCGTCT
GCGGTAGGCAATGGCTCGCATGCGACACTGGCCGAGGTGCCCAACCATGGCATCAGCGATGAGACGAGCCGTAGT
CATGTTGCCAGTGCCGACGTGGAAAACGAACATGACTCGAAAACTGAAGACAGCGATGACAGAATCAAGGTTGAA
ACCGAACTTGTCACTAGTGATGTCAACACCAAGCCTGCTGCTATACTCGCGCCTCCTCCCCTCAAAGCCAACCTC
GCATTACAGAGCAGTGCCTTTATCCCTAGAGCTTTATCAACCACTGACACTTCATTGACTGATTCCCAACCCAAG
CGCAAGCACCCTGGCTCAGATGCTTCTCCGGCAAAGCGACAGGAAAGAGAAAAACCTGCACCAGTAATGAAAGCT
CCTCAACGGGAACACCTGGCAGCCGATGAGGACGACAGTGACGAGAGCGCGCACCTCAATATGGAACTAGACGAG
GATGACGACGAGGAGGATGACGACGACGACGACGAGAAAAGCGGTCAAGAGGGCCAATAG
Gene >OphauG2|3449
ATGGCATCACAGCCTCCCCCCGACCTCGGAGTCCTCTGCACGAAGCTCTCCTCGACACCTGCCATCCAGCTTCCG
CATGCTCTTCCTGTCCTGACGCGGCACGTGGTGCGCTGCAAAGATGCGCTGTCAGCGCCCCAGGAACAAAAACTC
AAAGACAATGCCTCGCAGAGCTCGCTGCTCATTCATAAAATCAAGACCCAAATCATCACGCTCTTGAATGGGCGC
AGCCGTGAGGGTAGGTTCGCTGCCGTGGGCTTGGTCAAGGCCGTGATTGATGTCGGAGGCTGGGAAATGCTTCGC
GGCTCCGAGCCTTGGGTTCGCGGTCTTTTGTCCATCATGCAGGTTAGCCCCCGTCCAGATGTAAAGGTCATGCTG
CTATCCATGCTAATCTTCTCATTTCTTCCGCCAAGAAAGGAGACTCGTTTGCTTGCAAAGAATTGGCCGTCGTGA
CTCTGACTCGCATTTACATGCTGCTTCATCCTTATCCAACACTGGCGAGGGAAATAGCAACGGCTACGCTCCCCG
CATTCATCACGGCCAGTCTCCAAATAGTCAAGTCTGATGGCTCTGTACCTCTAGCAGCTCCTTGCTCAATTGTCA
TGGGGGTATGCGAGGCCTTTGCAGCTTTGATACCACTCTACCCGACAACCTTTCGTCCGCATGCCTCTCAGATCC
GGTCATCCATAAGACTATACCTTGCGCCGACGACTTCGGATGCAGTCTTTGTTCCCCCATCTCTACAGCGTGCTG
CAGGCCGATTGACCGTTACTCTCCATCACGTCGCTGCAAAGTCGGGTGGAAGCGATGAATGGGCCAAGCTCATGG
ACGGCTTCTTGCGCGACCTTCACCTGACGGCTGACCAAGTCTTTCGCGCCGTCGACGAGTCCTGGGAAGCAAAAG
GCAACTTTCAGCGGGCCGCCGTGGCTCTGGATGGAGTCCCAAACGGGGGAGGCGTCTCAGCAGACCAATTGCCTA
CTTGGCAAGGGCTGAGCGCCGGTGCTCAGCGCATCATGGGACTGCTGGGTCTCGTGTCGGACGCTTTGTGCTGCC
AAACTAAAGGAGCTGTTGAAATTCCTCTGGGAGCCATAATGACTGCAGTTTCTCGCATCTGCTCCATAGCCCGAC
TTTCGCCAAAGGCTCAAAGCTGGCACCAGGCTGTCGAGACAAACCCTGCCATAGGCAGAGACGAGAGGGACGAGC
TCTGGAGTGTCATGCCCGACCTCCACGTGGGAGCCATGGAAGTAGTCCTGGTGATGCTGCGCAGACTCCAACAGA
GCATGCTCCCTCTGGTCCAGGAGCTGTCAGACCATGTCGTCCGCGTCTTCAAGTCGGGCATGGACGTTGCAGCAG
TCCGCAAAACTGGCTATCTTGTTCTCGCCAACCTTTTATCCCTGGCCGGGCCAACGCTGCCGAAGCAATCCGTGG
CCATGGTAGAGCTCCTCGTCATCGCCTGCTGTCGCGACCTGCAGCACAACGCGTCTCTCAGCGTCAATTCGCCGT
CGATGCCAGCCACAGATACCAAGGCCAATGCCATGGCCAACGCCGACCTCTTTCTACAACCATCCTCAGCTCCAT
CCCCAGGACTGGCAACCACCAAGCTTGACCTGGATCACGCCGCCGCTGCTACTAATCTCCTGCCTGTACTGCTGT
CCCATCTCCCGCAACAACACATCAAGCCCTCGCTTCGTGGCCTCGTGGACAGAACGGCCATTCTTACGCGGAACC
GTGACGCTATGCTCGCCAGCGTGCTAAATCCTTATCGCGACAGCAGCGGGCGCATGTTGCCTTCGATTCTGCCTC
ATCTCTCGCGTCAGTTTCCTCACGACCAGGCACTCGAAGTACTGCGTTGCAACATGCGCACCTCGTCTGCGGTAG
GCAATGGCTCGCATGCGACACTGGCCGAGGTGCCCAACCATGGCATCAGCGATGAGACGAGCCGTAGTCATGTTG
CCAGTGCCGACGTGGAAAACGAACATGACTCGAAAACTGAAGACAGCGATGACAGAATCAAGGTTGAAACCGAAC
TTGTCACTAGTGATGTCAACACCAAGCCTGCTGCTATACTCGCGCCTCCTCCCCTCAAAGCCAACCTCGCATTAC
AGAGCAGTGCCTTTATCCCTAGAGCTTTATCAACCACTGACACTTCATTGACTGATTCCCAACCCAAGCGCAAGC
ACCCTGGCTCAGATGCTTCTCCGGCAAAGCGACAGGAAAGAGAAAAACCTGCACCAGTAATGAAAGCTCCTCAAC
GGGAACACCTGGCAGCCGATGAGGACGACAGTGACGAGAGCGCGCACCTCAATATGGAACTAGACGAGGATGACG
ACGAGGAGGATGACGACGACGACGACGAGAAAAGCGGTCAAGAGGGCCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail