Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3433
Gene name
LocationContig_26:25471..26163
Strand+
Gene length (bp)692
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00935 Ribosomal_L44 Ribosomal protein L44 2.5E-34 19 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27075|RL44_CANTR 60S ribosomal protein L44 OS=Candida tropicalis GN=RPL44 PE=3 SV=2 1 106 3.0E-58
sp|P52809|RL44_CYBJA 60S ribosomal protein L44 OS=Cyberlindnera jadinii GN=RPL44 PE=3 SV=2 1 106 7.0E-58
sp|P27074|RL44Q_CANMA 60S ribosomal protein L44 Q OS=Candida maltosa GN=RIM-C PE=3 SV=2 1 106 8.0E-58
sp|Q6CFS7|RL44_YARLI 60S ribosomal protein L44 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL44 PE=3 SV=3 1 106 3.0E-57
sp|Q9UVB8|RL44_WICCF 60S ribosomal protein L44 OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=RPL44 PE=3 SV=3 1 106 4.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27075|RL44_CANTR 60S ribosomal protein L44 OS=Candida tropicalis GN=RPL44 PE=3 SV=2 1 106 3.0E-58
sp|P52809|RL44_CYBJA 60S ribosomal protein L44 OS=Cyberlindnera jadinii GN=RPL44 PE=3 SV=2 1 106 7.0E-58
sp|P27074|RL44Q_CANMA 60S ribosomal protein L44 Q OS=Candida maltosa GN=RIM-C PE=3 SV=2 1 106 8.0E-58
sp|Q6CFS7|RL44_YARLI 60S ribosomal protein L44 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL44 PE=3 SV=3 1 106 3.0E-57
sp|Q9UVB8|RL44_WICCF 60S ribosomal protein L44 OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=RPL44 PE=3 SV=3 1 106 4.0E-57
sp|Q6BLK0|RL44_DEBHA 60S ribosomal protein L44 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL44 PE=3 SV=3 1 106 1.0E-56
sp|P31866|RL44_PICGU 60S ribosomal protein L44 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPL44 PE=3 SV=3 1 106 2.0E-56
sp|Q00477|RL44P_CANMA 60S ribosomal protein L44 P OS=Candida maltosa GN=L41P1A PE=3 SV=3 1 106 4.0E-56
sp|Q4PNY0|RL44_CANGY 60S ribosomal protein L44 OS=Candida glycerinogenes GN=RPL44 PE=3 SV=3 1 106 9.0E-56
sp|P0CX28|RL44B_YEAST 60S ribosomal protein L42-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL42B PE=1 SV=1 1 106 2.0E-55
sp|P0CX27|RL44A_YEAST 60S ribosomal protein L42-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL42A PE=1 SV=1 1 106 2.0E-55
sp|P31028|RL44_SCHOC 60S ribosomal protein L44 OS=Schwanniomyces occidentalis GN=RPL44 PE=3 SV=2 1 106 2.0E-54
sp|P31027|RL44_KLULA 60S ribosomal protein L44 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPL44 PE=3 SV=2 1 106 6.0E-54
sp|O23290|RL36A_ARATH 60S ribosomal protein L36a OS=Arabidopsis thaliana GN=RPL36AA PE=2 SV=3 1 104 1.0E-53
sp|P27076|RL44_KLUMA 60S ribosomal protein L44 OS=Kluyveromyces marxianus GN=RPL44 PE=3 SV=2 1 106 3.0E-53
sp|Q96499|RL44_GOSHI 60S ribosomal protein L44 OS=Gossypium hirsutum GN=RPL44 PE=3 SV=3 1 104 1.0E-52
sp|P0CQ50|RL44_CRYNJ 60S ribosomal protein L44 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPL44 PE=3 SV=1 1 106 2.0E-52
sp|P0CQ51|RL44_CRYNB 60S ribosomal protein L44 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPL44 PE=3 SV=1 1 106 2.0E-52
sp|Q754N8|RL44_ASHGO 60S ribosomal protein L44 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL44 PE=3 SV=3 1 106 4.0E-52
sp|Q9UWE4|RL44_COPCI 60S ribosomal protein L44 OS=Coprinopsis cinerea GN=RPL44 PE=3 SV=3 1 106 8.0E-52
sp|A8PCG3|RL44_COPC7 60S ribosomal protein L44 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RPL44 PE=3 SV=2 1 106 8.0E-52
sp|O59870|RL44_PHARH 60S ribosomal protein L44 OS=Phaffia rhodozyma GN=RPL44 PE=3 SV=3 1 106 1.0E-51
sp|P61486|RL36A_TAKRU 60S ribosomal protein L36a OS=Takifugu rubripes GN=rpl36a PE=3 SV=2 1 106 3.0E-50
sp|P61487|RL36A_ICTPU 60S ribosomal protein L36a OS=Ictalurus punctatus GN=rpl36a PE=3 SV=2 1 106 3.0E-50
sp|P61485|RL36A_DANRE 60S ribosomal protein L36a OS=Danio rerio GN=rpl36a PE=3 SV=2 1 106 3.0E-50
sp|P48166|RL44_CAEEL 60S ribosomal protein L44 OS=Caenorhabditis elegans GN=rpl-41 PE=3 SV=2 1 106 5.0E-50
sp|Q9UTI8|RL44_SCHPO 60S ribosomal protein L42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl42 PE=1 SV=3 1 106 2.0E-49
sp|P83884|RL36A_PIG 60S ribosomal protein L36a OS=Sus scrofa GN=RPL36A PE=1 SV=2 1 106 5.0E-49
sp|P83882|RL36A_MOUSE 60S ribosomal protein L36a OS=Mus musculus GN=Rpl36a PE=1 SV=2 1 106 5.0E-49
sp|P83881|RL36A_HUMAN 60S ribosomal protein L36a OS=Homo sapiens GN=RPL36A PE=1 SV=2 1 106 5.0E-49
sp|D0VWQ4|RL36A_CANLF 60S ribosomal protein L36a OS=Canis lupus familiaris GN=Rpl36a PE=1 SV=1 1 106 5.0E-49
sp|Q3SZ59|RL36A_BOVIN 60S ribosomal protein L36a OS=Bos taurus GN=RPL36A PE=3 SV=3 1 106 5.0E-49
sp|P83883|RL36A_RAT 60S ribosomal protein L36a OS=Rattus norvegicus GN=Rpl36a PE=1 SV=2 1 106 5.0E-49
sp|Q969Q0|RL36L_HUMAN 60S ribosomal protein L36a-like OS=Homo sapiens GN=RPL36AL PE=1 SV=3 1 106 1.0E-48
sp|P90702|RL44_BRUMA 60S ribosomal protein L44 OS=Brugia malayi GN=rpl-44 PE=3 SV=3 1 106 4.0E-48
sp|Q5R9D2|RL36L_PONAB 60S ribosomal protein L36a-like OS=Pongo abelii GN=RPL36AL PE=3 SV=3 1 106 5.0E-48
sp|Q55CW5|RL36A_DICDI 60S ribosomal protein L36a OS=Dictyostelium discoideum GN=rpl36a PE=3 SV=2 1 104 4.0E-46
sp|P49213|RL44_CHLRE 60S ribosomal protein L44 OS=Chlamydomonas reinhardtii GN=RPL44 PE=3 SV=2 1 98 1.0E-45
sp|A9L948|RL36A_PAPAN 60S ribosomal protein L36a OS=Papio anubis GN=RPL36A PE=3 SV=1 1 106 2.0E-44
sp|Q9NB33|RL44_OCHTR 60S ribosomal protein L44 OS=Ochlerotatus triseriatus GN=RpL44 PE=3 SV=3 1 106 3.0E-43
sp|P17843|RL44_TRYBB 60S ribosomal protein L44 OS=Trypanosoma brucei brucei GN=RPL44 PE=3 SV=3 1 99 5.0E-39
sp|O97231|RL44_PLAF7 60S ribosomal protein L44 OS=Plasmodium falciparum (isolate 3D7) GN=RPL44 PE=1 SV=3 1 104 6.0E-36
sp|Q8SR18|RL44_ENCCU 60S ribosomal protein L44 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL44 PE=3 SV=1 1 106 1.0E-35
sp|Q22X38|RL36A_TETTS 60S ribosomal protein L36a OS=Tetrahymena thermophila (strain SB210) GN=RPL36A PE=1 SV=1 1 89 3.0E-27
sp|B8D537|RL44E_DESK1 50S ribosomal protein L44e OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl44e PE=3 SV=2 2 95 1.0E-16
sp|Q9YF00|RL44E_AERPE 50S ribosomal protein L44e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl44e PE=3 SV=2 2 93 5.0E-16
sp|Q9HIX1|RL44E_THEAC 50S ribosomal protein L44e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl44e PE=3 SV=1 2 93 4.0E-13
sp|F2L1X6|RL44E_THEU7 50S ribosomal protein L44e OS=Thermoproteus uzoniensis (strain 768-20) GN=rpl44e PE=3 SV=1 10 93 1.0E-11
sp|O27365|RL44E_METTH 50S ribosomal protein L44e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl44e PE=3 SV=1 2 77 7.0E-10
sp|P54027|RL44E_METJA 50S ribosomal protein L44e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl44e PE=3 SV=1 2 77 4.0E-09
sp|Q8U475|RL44E_PYRFU 50S ribosomal protein L44e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl44e PE=1 SV=1 2 93 1.0E-08
sp|Q9UXZ2|RL44E_PYRAB 50S ribosomal protein L44e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl44e PE=3 SV=1 2 93 6.0E-08
sp|O59603|RL44E_PYRHO 50S ribosomal protein L44e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl44e PE=3 SV=2 5 93 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3979
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3433 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7125
Ophiocordyceps camponoti-floridani Ophcf2|05458
Ophiocordyceps camponoti-rufipedis Ophun1|5170
Ophiocordyceps kimflemingae Ophio5|6926
Ophiocordyceps subramaniannii Hirsu2|7950

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3433
MVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECV
KCKTKSQLALKRCKHFELGGDKKTKGAALVF*
Coding >OphauG2|3433
ATGGTCAACATCCCCAAGACCCGAAACACTTATTGCAAGGGCAAGGAGTGCCGCAAGCACACCCAGCACAAGGTT
ACTCAATACAAGGCTGGCAAGGCCTCCCTATTCGCCCAGGGAAAGCGGCGTTACGACAGAAAGCAATCCGGTTAC
GGTGGTCAGACCAAGCCCGTCTTCCACAAGAAGGCCAAAACTACCAAGAAGGTTGTCCTGAGATTGGAGTGCGTC
AAGTGCAAGACCAAGTCGCAGCTAGCATTGAAACGATGCAAGCACTTTGAGTTGGGCGGTGACAAGAAGACAAAG
GGCGCAGCTCTGGTGTTCTAA
Transcript >OphauG2|3433
ATGGTCAACATCCCCAAGACCCGAAACACTTATTGCAAGGGCAAGGAGTGCCGCAAGCACACCCAGCACAAGGTT
ACTCAATACAAGGCTGGCAAGGCCTCCCTATTCGCCCAGGGAAAGCGGCGTTACGACAGAAAGCAATCCGGTTAC
GGTGGTCAGACCAAGCCCGTCTTCCACAAGAAGGCCAAAACTACCAAGAAGGTTGTCCTGAGATTGGAGTGCGTC
AAGTGCAAGACCAAGTCGCAGCTAGCATTGAAACGATGCAAGCACTTTGAGTTGGGCGGTGACAAGAAGACAAAG
GGCGCAGCTCTGGTGTTCTAA
Gene >OphauG2|3433
ATGGTATGTATGGGCAACGCCAAACTTTCTTTTGACTTTGATGCAGCGACGCCCATCACTTTGAGCAGGAATCGC
GAGCGATGGCCGGCGCAGACGGGTCGGCAACGATGATGAAGCGGCCAGTTCAAGAGTAATCCATTACGACCGAGG
CAAGCTTCAAAAGTCTTCCCGACTCGACGCAGATTTCAAATCGCCGCCTCAATTCGACAAGAAAAGATGGATTTT
TCTCCCAGATGGCGCTGCCCGGCGATCGCTCGCGAACTGCACCGGACCGTGGGCAACTTGATTTGTCAAGCATGG
AGCTGACTTTGATCTCCCAAGGTCAACATCCCCAAGACCCGAAACACTTATTGCAAGGGCAAGGAGTGCCGCAAG
CACACCCAGCACAAGGTTACTCAATACAAGGCTGGCAAGGCCTCCCTATTCGCCCAGGGAAAGCGGCGTTACGAC
AGAAAGCAATCCGGTTACGGTGGTCAGACCAAGCCCGTCTTCCACAAGAAGGCCAAAACTACCAAGAAGGTTGTC
CTGAGATTGGAGTGCGTCAAGTGCAAGACCAAGTCGCAGCTAGCATTGAAACGATGCAAGCACTTTGAGTTGGGG
TATGTGCCAATTACCCTGCTTGGCATCGATGAAGCGCTAACAGCGAATGCAGCGGTGACAAGAAGACAAAGGGCG
CAGCTCTGGTGTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail