Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3432
Gene name
LocationContig_26:23693..24756
Strand-
Gene length (bp)1063
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04733 Coatomer_E Coatomer epsilon subunit 5.1E-59 8 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZIK9|COPE_CHICK Coatomer subunit epsilon OS=Gallus gallus GN=COPE PE=2 SV=1 9 290 2.0E-30
sp|Q60445|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2 9 290 3.0E-30
sp|Q28104|COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus GN=COPE PE=1 SV=3 9 290 8.0E-29
sp|Q5RFR8|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1 9 290 1.0E-28
sp|O89079|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=1 SV=3 9 290 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZIK9|COPE_CHICK Coatomer subunit epsilon OS=Gallus gallus GN=COPE PE=2 SV=1 9 290 2.0E-30
sp|Q60445|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2 9 290 3.0E-30
sp|Q28104|COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus GN=COPE PE=1 SV=3 9 290 8.0E-29
sp|Q5RFR8|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1 9 290 1.0E-28
sp|O89079|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=1 SV=3 9 290 2.0E-28
sp|O14579|COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens GN=COPE PE=1 SV=3 9 290 2.0E-28
sp|Q9SA78|COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana GN=At1g30630 PE=2 SV=1 10 268 9.0E-26
sp|O74767|COPE_SCHPO Probable coatomer subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec28 PE=1 SV=1 5 253 1.0E-24
sp|Q9MAX6|COPE1_ORYSJ Coatomer subunit epsilon-1 OS=Oryza sativa subsp. japonica GN=COPE1 PE=2 SV=1 10 268 1.0E-23
sp|O64748|COPE2_ARATH Coatomer subunit epsilon-2 OS=Arabidopsis thaliana GN=At2g34840 PE=2 SV=1 10 284 4.0E-23
sp|P0C541|COPE2_ORYSJ Coatomer subunit epsilon-2 OS=Oryza sativa subsp. japonica GN=Os04g0644700 PE=3 SV=1 9 285 2.0E-22
sp|A2XY73|COPE2_ORYSI Coatomer subunit epsilon-2 OS=Oryza sativa subsp. indica GN=H0413E07.10 PE=3 SV=2 9 285 7.0E-22
sp|O62246|COPE_CAEEL Coatomer subunit epsilon OS=Caenorhabditis elegans GN=cope-1 PE=3 SV=1 9 286 1.0E-15
sp|Q55FU2|COPE_DICDI Coatomer subunit epsilon OS=Dictyostelium discoideum GN=cope PE=3 SV=1 101 289 1.0E-12
sp|P40509|COPE_YEAST Coatomer subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC28 PE=1 SV=2 164 289 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3980
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3432 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7124
Ophiocordyceps camponoti-floridani Ophcf2|05459
Ophiocordyceps camponoti-rufipedis Ophun1|5169
Ophiocordyceps kimflemingae Ophio5|6927
Ophiocordyceps subramaniannii Hirsu2|7953

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3432
MDPYSTEGELINIHNHFHQGQYQHVIDFDTSSFSPDNALPARILQLRARIALGQAREVLAEIQGEQQLELQALSA
LAQCELGQTDAALETVARLAASNADNATVQIIGGTILEVAGQSEQALALLSQHQASLEAVALLAQIYLRQNRTDL
ALKEVTAARSWAQDSLLVNLAESWVGARMGGEKYQQAFYVFEELAQAAATESVRSHVAQAICEIHLGRLEEAQAA
LEQALSKEPKFGDAIANTIVLNTLLGTDTKELTETLQKVAPTHPFLLDMEEKSALFDKAAAKYSPRVAST*
Coding >OphauG2|3432
ATGGATCCATACTCGACAGAAGGCGAATTGATTAATATCCACAATCACTTCCATCAGGGCCAGTATCAGCATGTC
ATTGACTTTGACACGTCGTCCTTTTCTCCAGACAATGCTCTCCCTGCACGCATCCTCCAGCTTCGGGCACGCATC
GCCTTAGGACAGGCCAGGGAGGTCCTCGCAGAAATTCAAGGCGAGCAGCAGCTTGAGCTCCAAGCGCTGAGTGCG
CTTGCTCAATGCGAGCTGGGACAGACAGATGCTGCCCTGGAGACGGTGGCAAGGCTAGCCGCGTCGAATGCCGAC
AATGCCACCGTCCAAATAATCGGTGGCACCATTCTCGAGGTTGCCGGACAGTCCGAGCAAGCGCTTGCACTGCTC
TCGCAACATCAGGCAAGCCTCGAGGCGGTTGCGCTTCTTGCTCAAATCTATTTACGACAGAACCGAACCGATCTC
GCCCTCAAGGAAGTCACAGCAGCAAGAAGTTGGGCTCAGGATAGTTTACTGGTCAATTTAGCCGAGTCCTGGGTC
GGAGCCAGAATGGGCGGCGAAAAATATCAACAAGCATTCTATGTGTTTGAAGAGCTTGCTCAGGCTGCAGCCACT
GAATCAGTTCGCAGCCATGTCGCACAGGCTATATGTGAGATACACTTGGGCCGGTTAGAAGAAGCGCAAGCAGCA
TTGGAGCAAGCCTTGAGCAAAGAGCCGAAATTCGGCGATGCAATTGCCAATACAATTGTTCTAAACACTCTGTTA
GGCACAGATACCAAGGAGCTTACCGAAACTCTTCAAAAAGTGGCACCCACTCACCCGTTTCTGCTCGACATGGAG
GAGAAGAGTGCCTTATTCGACAAGGCAGCGGCTAAATACAGCCCCAGGGTTGCTTCCACTTAG
Transcript >OphauG2|3432
ATGGATCCATACTCGACAGAAGGCGAATTGATTAATATCCACAATCACTTCCATCAGGGCCAGTATCAGCATGTC
ATTGACTTTGACACGTCGTCCTTTTCTCCAGACAATGCTCTCCCTGCACGCATCCTCCAGCTTCGGGCACGCATC
GCCTTAGGACAGGCCAGGGAGGTCCTCGCAGAAATTCAAGGCGAGCAGCAGCTTGAGCTCCAAGCGCTGAGTGCG
CTTGCTCAATGCGAGCTGGGACAGACAGATGCTGCCCTGGAGACGGTGGCAAGGCTAGCCGCGTCGAATGCCGAC
AATGCCACCGTCCAAATAATCGGTGGCACCATTCTCGAGGTTGCCGGACAGTCCGAGCAAGCGCTTGCACTGCTC
TCGCAACATCAGGCAAGCCTCGAGGCGGTTGCGCTTCTTGCTCAAATCTATTTACGACAGAACCGAACCGATCTC
GCCCTCAAGGAAGTCACAGCAGCAAGAAGTTGGGCTCAGGATAGTTTACTGGTCAATTTAGCCGAGTCCTGGGTC
GGAGCCAGAATGGGCGGCGAAAAATATCAACAAGCATTCTATGTGTTTGAAGAGCTTGCTCAGGCTGCAGCCACT
GAATCAGTTCGCAGCCATGTCGCACAGGCTATATGTGAGATACACTTGGGCCGGTTAGAAGAAGCGCAAGCAGCA
TTGGAGCAAGCCTTGAGCAAAGAGCCGAAATTCGGCGATGCAATTGCCAATACAATTGTTCTAAACACTCTGTTA
GGCACAGATACCAAGGAGCTTACCGAAACTCTTCAAAAAGTGGCACCCACTCACCCGTTTCTGCTCGACATGGAG
GAGAAGAGTGCCTTATTCGACAAGGCAGCGGCTAAATACAGCCCCAGGGTTGCTTCCACTTAG
Gene >OphauG2|3432
ATGGATCCATACTCGACAGAAGGCGAATTGATTAATATCCACAATCACTTCCATCAGGGCCAGTATCAGCATGTC
ATTGACTTTGACACGTCGTCCTTTTCTCCAGACAATGCTCTCCCTGCACGCATCCTCCAGCTTCGGGCACGCATC
GCCTTAGGACAGGCCAGGGAGGTCCTCGCAGAAATTCAAGGCGAGCAGCAGCTTGAGCTCCAAGCGCTGAGTGCG
CTTGCTCAATGCGAGCTGGGACAGACAGATGCTGCCCTGGAGACGGTGGCAAGGCTAGCCGCGTCGAATGCCGAC
AATGCCACCGTCCAAATAATCGGTGGCACCATTCTCGAGGTTGCCGGACAGTCCGAGCAAGCGCTTGCACTGCTC
TCGCAACATCAGGCAAGCCGTAAGTGCTTGTGGCTCTGGCCTTTCTCTTTTTCTTTGCGTGTGGCTAAAGCAAAG
GTGTTGTAGTCGAGGCGGTTGCGCTTCTTGCTCAAATCTATTTACGACAGAACCGAACCGATCTCGCCCTCAAGG
AAGTCACAGCAGCAAGAAGTTGGGCTCAGGATAGTTTACTGGTCAATTTAGCCGAGTCCTGGGTCGGAGCCAGAA
TGGTGAAGATGATCTATTTCCAAATGTTCCCGAGTGTTCGCAGCTAACGAGATACTCAAGGGCGGCGAAAAATAT
CAACAAGCATTCTATGTGTTTGAAGAGCTTGCTCAGGCTGCAGCCACTGAATCAGTTCGCAGCCATGTCGCACAG
GCTATATGTGAGATACACTTGGGCCGGTTAGAAGAAGCGCAAGCAGCATTGGAGCAAGCCTTGAGCAAAGAGCCG
AAATTCGGCGATGCAATTGCCAATACAATTGTTCTAAACACTCTGTTAGGCACAGATACCAAGGAGCTTACCGAG
TAAGTGACAATACCTCTAGCAGTCTTGGAACGCCGCGTTGACAATTCCAAGAACTCTTCAAAAAGTGGCACCCAC
TCACCCGTTTCTGCTCGACATGGAGGAGAAGAGTGCCTTATTCGACAAGGCAGCGGCTAAATACAGCCCCAGGGT
TGCTTCCACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail