Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3430
Gene name
LocationContig_26:20966..21480
Strand+
Gene length (bp)514
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08523 MBF1 Multiprotein bridging factor 1 1.1E-27 2 78
PF01381 HTH_3 Helix-turn-helix 3.3E-10 88 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q53IP3|MBF1_GIBFU Multiprotein-bridging factor 1 OS=Gibberella fujikuroi GN=MBF1 PE=3 SV=1 1 153 6.0E-83
sp|Q4WX89|MBF1_ASPFU Multiprotein-bridging factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mbf1 PE=3 SV=1 1 153 5.0E-69
sp|Q5B8Y4|MBF1_EMENI Multiprotein-bridging factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mbf1 PE=3 SV=1 1 153 6.0E-67
sp|Q871W6|MBF1_NEUCR Multiprotein-bridging factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mbf-1 PE=3 SV=1 1 145 4.0E-58
sp|Q6BXQ8|MBF1_DEBHA Multiprotein-bridging factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MBF1 PE=3 SV=1 1 153 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q53IP3|MBF1_GIBFU Multiprotein-bridging factor 1 OS=Gibberella fujikuroi GN=MBF1 PE=3 SV=1 1 153 6.0E-83
sp|Q4WX89|MBF1_ASPFU Multiprotein-bridging factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mbf1 PE=3 SV=1 1 153 5.0E-69
sp|Q5B8Y4|MBF1_EMENI Multiprotein-bridging factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mbf1 PE=3 SV=1 1 153 6.0E-67
sp|Q871W6|MBF1_NEUCR Multiprotein-bridging factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mbf-1 PE=3 SV=1 1 145 4.0E-58
sp|Q6BXQ8|MBF1_DEBHA Multiprotein-bridging factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MBF1 PE=3 SV=1 1 153 2.0E-43
sp|Q8TG23|MBF1_YARLI Putative multi-protein-binding factor 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MBF1 PE=3 SV=1 3 153 3.0E-42
sp|O14467|MBF1_YEAST Multiprotein-bridging factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBF1 PE=1 SV=2 1 147 6.0E-41
sp|Q6FJN0|MBF1_CANGA Multiprotein-bridging factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MBF1 PE=3 SV=1 1 147 7.0E-40
sp|O94700|MBF1_SCHPO Multiprotein-bridging factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbf1 PE=3 SV=1 1 147 1.0E-38
sp|Q6CIP4|MBF1_KLULA Multiprotein-bridging factor 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBF1 PE=3 SV=2 1 147 1.0E-38
sp|Q752P7|MBF1_ASHGO Multiprotein-bridging factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MBF1 PE=3 SV=1 2 147 1.0E-38
sp|Q5A940|MBF1_CANAL Multiprotein-bridging factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MBF1 PE=3 SV=1 2 153 3.0E-38
sp|P0CO31|MBF1_CRYNB Multiprotein-bridging factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MBF1 PE=3 SV=1 1 153 1.0E-27
sp|P0CO30|MBF1_CRYNJ Multiprotein-bridging factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MBF1 PE=3 SV=1 1 153 1.0E-27
sp|Q52BY4|MBF1_MAGO7 Multiprotein-bridging factor 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MBF1 PE=3 SV=1 3 148 3.0E-27
sp|Q6GPQ6|EDF1_XENLA Endothelial differentiation-related factor 1 homolog OS=Xenopus laevis GN=edf1 PE=2 SV=1 2 153 6.0E-24
sp|O60869|EDF1_HUMAN Endothelial differentiation-related factor 1 OS=Homo sapiens GN=EDF1 PE=1 SV=1 2 147 2.0E-22
sp|Q3T0V7|EDF1_BOVIN Endothelial differentiation-related factor 1 OS=Bos taurus GN=EDF1 PE=2 SV=1 2 147 2.0E-22
sp|P69736|EDF1_RAT Endothelial differentiation-related factor 1 OS=Rattus norvegicus GN=Edf1 PE=1 SV=1 2 147 3.0E-22
sp|Q9JMG1|EDF1_MOUSE Endothelial differentiation-related factor 1 OS=Mus musculus GN=Edf1 PE=1 SV=1 2 147 3.0E-22
sp|Q5ZMC0|EDF1_CHICK Endothelial differentiation-related factor 1 homolog OS=Gallus gallus GN=EDF1 PE=2 SV=1 2 147 7.0E-22
sp|Q6PBY3|EDF1_DANRE Endothelial differentiation-related factor 1 homolog OS=Danio rerio GN=edf1 PE=2 SV=1 3 147 9.0E-20
sp|P14327|VSH7_DICDI Vegetative-specific protein H7 OS=Dictyostelium discoideum GN=cinD-1 PE=2 SV=2 66 147 8.0E-14
sp|Q9LV58|MBF1C_ARATH Multiprotein-bridging factor 1c OS=Arabidopsis thaliana GN=MBF1C PE=1 SV=1 3 141 5.0E-13
sp|Q9LXT3|MBF1B_ARATH Multiprotein-bridging factor 1b OS=Arabidopsis thaliana GN=MBF1B PE=2 SV=1 3 141 8.0E-13
sp|Q9SJI8|MBF1A_ARATH Multiprotein-bridging factor 1a OS=Arabidopsis thaliana GN=MBF1A PE=2 SV=1 16 141 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3982
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3430 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7122
Ophiocordyceps camponoti-floridani Ophcf2|05461
Ophiocordyceps camponoti-rufipedis Ophun1|5167
Ophiocordyceps kimflemingae Ophio5|6929
Ophiocordyceps subramaniannii Hirsu2|7955

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3430
MSDWDNVTKIGSKVRGPGTAERETVVRGKSALNAAQRSGGVVATEKKYASANASSSGTEGQRLTKVDRSDDIIKP
NTVGKQVGDCISAARQKMEPKMTQKDLATRCNTTQSIVADFERGSATPDQKVLSSMERVLNVKLRGTDIGAPKFP
NKK*
Coding >OphauG2|3430
ATGTCGGACTGGGACAACGTCACCAAGATTGGCAGCAAGGTCCGTGGCCCGGGAACTGCCGAGCGCGAAACCGTG
GTTCGAGGCAAGAGTGCTCTCAACGCTGCCCAGCGCAGCGGCGGAGTTGTTGCGACGGAAAAAAAGTACGCCTCA
GCCAACGCGTCCTCGAGCGGAACAGAAGGCCAGCGCCTGACAAAGGTTGACCGCTCCGACGACATCATCAAGCCA
AACACGGTCGGCAAGCAGGTCGGCGACTGCATTTCGGCTGCGCGCCAGAAGATGGAGCCCAAGATGACTCAAAAG
GACCTGGCCACGCGCTGCAACACGACCCAGTCCATCGTTGCCGACTTTGAGCGAGGCTCAGCCACTCCCGACCAA
AAGGTGCTTTCTTCCATGGAGCGCGTCCTCAATGTCAAGTTGCGCGGCACCGACATTGGGGCTCCCAAGTTTCCC
AACAAGAAGTGA
Transcript >OphauG2|3430
ATGTCGGACTGGGACAACGTCACCAAGATTGGCAGCAAGGTCCGTGGCCCGGGAACTGCCGAGCGCGAAACCGTG
GTTCGAGGCAAGAGTGCTCTCAACGCTGCCCAGCGCAGCGGCGGAGTTGTTGCGACGGAAAAAAAGTACGCCTCA
GCCAACGCGTCCTCGAGCGGAACAGAAGGCCAGCGCCTGACAAAGGTTGACCGCTCCGACGACATCATCAAGCCA
AACACGGTCGGCAAGCAGGTCGGCGACTGCATTTCGGCTGCGCGCCAGAAGATGGAGCCCAAGATGACTCAAAAG
GACCTGGCCACGCGCTGCAACACGACCCAGTCCATCGTTGCCGACTTTGAGCGAGGCTCAGCCACTCCCGACCAA
AAGGTGCTTTCTTCCATGGAGCGCGTCCTCAATGTCAAGTTGCGCGGCACCGACATTGGGGCTCCCAAGTTTCCC
AACAAGAAGTGA
Gene >OphauG2|3430
ATGTCGGACTGGGACAACGTCACCAAGATTGGCAGCAAGGTCCGTGGCCCGGGAACTGCCGAGCGCGAAACCGTG
GTTCGAGGCAAGAGTGCTCTCAACGCTGCCCAGCGCAGCGGCGGAGTTGTTGCGACGGAAAAAAAGTACGCCTCA
GCCAACGCGGTATGCTGCCCCCTCGCTCCCAGCCGTGGCCATGGCTAACTCGCCTCTCCAGTCCTCGAGCGGAAC
AGAAGGCCAGCGCCTGACAAAGGTTGACCGCTCCGACGACATCATCAAGCCAAACACGGTCGGCAAGCAGGTCGG
CGACTGCATTTCGGCTGCGCGCCAGAAGATGGAGCCCAAGATGACTCAAAAGGACCTGGCCACGCGCTGCAACAC
GACCCAGTCCATCGTTGCCGACTTTGAGCGAGGCTCAGCCACTCCCGACCAAAAGGTGCTTTCTTCCATGGAGCG
CGTCCTCAATGTCAAGTTGCGCGGCACCGACATTGGGGCTCCCAAGTTTCCCAACAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail