Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3420
Gene name
LocationContig_259:20196..21476
Strand-
Gene length (bp)1280
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.7E-39 74 383
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.0E-08 69 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 1 400 4.0E-130
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 1 383 4.0E-99
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 1 322 2.0E-83
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 15 392 1.0E-76
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 15 392 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 1 400 4.0E-130
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 1 383 4.0E-99
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 1 322 2.0E-83
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 15 392 1.0E-76
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 15 392 2.0E-76
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 234 385 1.0E-27
sp|P40231|CSK2A_SCHPO Casein kinase II subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cka1 PE=2 SV=2 10 385 1.0E-26
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 7 192 6.0E-26
sp|P19454|CSK22_YEAST Casein kinase II subunit alpha' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA2 PE=1 SV=2 10 383 7.0E-24
sp|Q02720|CSK2A_DICDI Casein kinase II subunit alpha OS=Dictyostelium discoideum GN=casK PE=2 SV=1 105 383 3.0E-23
sp|Q4U925|CSK2A_THEAN Casein kinase II subunit alpha OS=Theileria annulata GN=TA10630 PE=3 SV=2 98 383 3.0E-21
sp|Q54LR6|Y6481_DICDI Probable serine/threonine-protein kinase DDB_G0286481 OS=Dictyostelium discoideum GN=DDB_G0286481 PE=3 SV=1 7 393 4.0E-21
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 15 385 1.0E-20
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 1 191 1.0E-20
sp|P28547|CSK2A_THEPA Casein kinase II subunit alpha OS=Theileria parva GN=TP04_0659 PE=3 SV=2 98 383 1.0E-20
sp|Q08466|CSK22_ARATH Casein kinase II subunit alpha-2 OS=Arabidopsis thaliana GN=CKA2 PE=2 SV=3 105 384 1.0E-20
sp|P43068|MKC1_CANAX Mitogen-activated protein kinase MKC1 OS=Candida albicans GN=MKC1 PE=3 SV=1 15 385 2.0E-20
sp|P19784|CSK22_HUMAN Casein kinase II subunit alpha' OS=Homo sapiens GN=CSNK2A2 PE=1 SV=1 123 383 3.0E-20
sp|P15790|CSK21_YEAST Casein kinase II subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA1 PE=1 SV=1 123 384 9.0E-20
sp|P20427|CSK22_BOVIN Casein kinase II subunit alpha' OS=Bos taurus GN=CSNK2A2 PE=1 SV=3 123 383 9.0E-20
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 237 316 1.0E-19
sp|Q08467|CSK21_ARATH Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana GN=CKA1 PE=1 SV=3 98 384 1.0E-19
sp|O54833|CSK22_MOUSE Casein kinase II subunit alpha' OS=Mus musculus GN=Csnk2a2 PE=1 SV=1 123 383 1.0E-19
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 237 316 1.0E-19
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 1 191 1.0E-19
sp|P21869|CSK22_CHICK Casein kinase II subunit alpha' OS=Gallus gallus PE=2 SV=1 123 383 1.0E-19
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 16 383 2.0E-19
sp|P08181|CSK2A_DROME Casein kinase II subunit alpha OS=Drosophila melanogaster GN=CkIIalpha PE=1 SV=2 123 383 1.0E-18
sp|Q8TG13|CSK2A_NEUCR Casein kinase II subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cka PE=2 SV=1 98 384 1.0E-18
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 13 383 2.0E-18
sp|O64817|CSK23_ARATH Probable casein kinase II subunit alpha OS=Arabidopsis thaliana GN=At2g23080 PE=1 SV=1 123 384 2.0E-18
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 21 384 3.0E-18
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 13 383 4.0E-18
sp|P18334|CSK2A_CAEEL Casein kinase II subunit alpha OS=Caenorhabditis elegans GN=kin-3 PE=1 SV=1 123 383 7.0E-18
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 15 383 1.0E-17
sp|P28523|CSK2A_MAIZE Casein kinase II subunit alpha OS=Zea mays GN=ACK2 PE=1 SV=1 105 383 2.0E-17
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 13 397 4.0E-17
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 15 384 4.0E-17
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 14 383 6.0E-17
sp|O64816|CSK2P_ARATH Casein kinase II subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=At2g23070 PE=2 SV=1 105 383 6.0E-17
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 15 305 6.0E-17
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 144 383 7.0E-17
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 15 383 7.0E-17
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 144 383 7.0E-17
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 144 383 8.0E-17
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 13 383 1.0E-16
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 144 383 1.0E-16
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 139 400 2.0E-16
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 15 383 2.0E-16
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 21 383 3.0E-16
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 13 391 3.0E-16
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 13 383 3.0E-16
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 94 383 6.0E-16
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 10 389 6.0E-16
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 13 392 7.0E-16
sp|Q8SR86|CDK1_ENCCU Cyclin-dependent kinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC28 PE=3 SV=1 11 383 7.0E-16
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 137 398 7.0E-16
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 15 305 8.0E-16
sp|Q60737|CSK21_MOUSE Casein kinase II subunit alpha OS=Mus musculus GN=Csnk2a1 PE=1 SV=2 98 383 8.0E-16
sp|P33674|CSK21_RABIT Casein kinase II subunit alpha OS=Oryctolagus cuniculus GN=CSNK2A1 PE=2 SV=1 98 383 8.0E-16
sp|P19139|CSK21_RAT Casein kinase II subunit alpha OS=Rattus norvegicus GN=Csnk2a1 PE=1 SV=2 98 383 8.0E-16
sp|P21868|CSK21_CHICK Casein kinase II subunit alpha OS=Gallus gallus GN=CSNK2A1 PE=2 SV=1 98 383 9.0E-16
sp|P68400|CSK21_HUMAN Casein kinase II subunit alpha OS=Homo sapiens GN=CSNK2A1 PE=1 SV=1 98 383 9.0E-16
sp|P68399|CSK21_BOVIN Casein kinase II subunit alpha OS=Bos taurus GN=CSNK2A1 PE=1 SV=1 98 383 9.0E-16
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 144 393 1.0E-15
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 15 390 1.0E-15
sp|O76484|CSK2A_SPOFR Casein kinase II subunit alpha OS=Spodoptera frugiperda PE=2 SV=1 123 383 1.0E-15
sp|P28020|CSK21_XENLA Casein kinase II subunit alpha OS=Xenopus laevis GN=csnk2a1 PE=2 SV=2 98 383 1.0E-15
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 9 386 1.0E-15
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 77 392 2.0E-15
sp|P14681|KSS1_YEAST Mitogen-activated protein kinase KSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSS1 PE=1 SV=1 77 385 2.0E-15
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 15 383 2.0E-15
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 139 384 2.0E-15
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 147 384 2.0E-15
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 139 384 2.0E-15
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 147 384 3.0E-15
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 15 383 3.0E-15
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 15 383 3.0E-15
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 11 385 3.0E-15
sp|Q4WTN5|BUR1_ASPFU Serine/threonine-protein kinase bur1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bur1 PE=3 SV=1 15 391 3.0E-15
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 139 384 4.0E-15
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 14 383 5.0E-15
sp|Q8NEV1|CSK23_HUMAN Casein kinase II subunit alpha 3 OS=Homo sapiens GN=CSNK2A3 PE=1 SV=2 98 383 5.0E-15
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 76 392 5.0E-15
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 15 383 6.0E-15
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 139 396 7.0E-15
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 15 383 8.0E-15
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 15 383 9.0E-15
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 15 383 9.0E-15
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 14 383 1.0E-14
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 144 383 1.0E-14
sp|Q54Y06|Y8487_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0278487 OS=Dictyostelium discoideum GN=DDB_G0278487 PE=2 SV=1 11 404 1.0E-14
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 147 396 1.0E-14
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 39 384 2.0E-14
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 15 393 2.0E-14
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 74 383 2.0E-14
sp|Q39021|MPK1_ARATH Mitogen-activated protein kinase 1 OS=Arabidopsis thaliana GN=MPK1 PE=1 SV=2 77 384 2.0E-14
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 14 383 2.0E-14
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 139 384 2.0E-14
sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens GN=GSK3A PE=1 SV=2 144 383 3.0E-14
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 144 383 3.0E-14
sp|P18265|GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus GN=Gsk3a PE=1 SV=1 144 383 3.0E-14
sp|Q8SRU0|CSK2A_ENCCU Probable casein kinase II subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CKA1 PE=3 SV=1 123 309 3.0E-14
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 14 383 3.0E-14
sp|P38615|RIM11_YEAST Serine/threonine-protein kinase RIM11/MSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM11 PE=1 SV=1 139 387 3.0E-14
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 13 385 3.0E-14
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 11 384 3.0E-14
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 15 393 4.0E-14
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 15 386 4.0E-14
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 14 382 4.0E-14
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 77 383 4.0E-14
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 144 400 5.0E-14
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 14 383 5.0E-14
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 77 383 5.0E-14
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 14 383 5.0E-14
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 15 386 6.0E-14
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 137 383 6.0E-14
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 77 384 6.0E-14
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 14 383 6.0E-14
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 77 384 6.0E-14
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 15 393 6.0E-14
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 13 394 6.0E-14
sp|Q12222|YGK3_YEAST Glycogen synthase kinase-3 homolog YGK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGK3 PE=1 SV=1 78 383 7.0E-14
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 15 393 8.0E-14
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 75 384 8.0E-14
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 14 383 8.0E-14
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 13 383 9.0E-14
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 75 384 9.0E-14
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 13 383 9.0E-14
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 139 384 9.0E-14
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 137 384 1.0E-13
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 139 384 1.0E-13
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 75 384 1.0E-13
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 14 383 1.0E-13
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 139 384 1.0E-13
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 119 383 2.0E-13
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 77 385 2.0E-13
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 72 383 2.0E-13
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 77 384 2.0E-13
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 13 383 2.0E-13
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 77 383 2.0E-13
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 75 384 2.0E-13
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 14 383 3.0E-13
sp|Q9DGE1|MK14B_DANRE Mitogen-activated protein kinase 14B OS=Danio rerio GN=mapk14b PE=1 SV=1 77 400 3.0E-13
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 15 396 3.0E-13
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 139 383 3.0E-13
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 139 383 3.0E-13
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 139 383 3.0E-13
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 139 383 3.0E-13
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 139 383 3.0E-13
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 77 385 3.0E-13
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 14 383 4.0E-13
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 139 383 4.0E-13
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 139 383 4.0E-13
sp|Q15759|MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens GN=MAPK11 PE=1 SV=2 90 384 4.0E-13
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 139 383 4.0E-13
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 139 383 4.0E-13
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 15 383 4.0E-13
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 139 396 5.0E-13
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 14 383 5.0E-13
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 144 383 6.0E-13
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 90 289 7.0E-13
sp|Q39027|MPK7_ARATH Mitogen-activated protein kinase 7 OS=Arabidopsis thaliana GN=MPK7 PE=1 SV=2 39 384 9.0E-13
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 147 396 1.0E-12
sp|G5EBT1|SMA5_CAEEL Mitogen-activated protein kinase sma-5 OS=Caenorhabditis elegans GN=sma-5 PE=2 SV=1 2 383 1.0E-12
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 147 396 1.0E-12
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 147 396 1.0E-12
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 137 385 1.0E-12
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 137 383 1.0E-12
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 35 401 2.0E-12
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 77 384 2.0E-12
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 139 383 2.0E-12
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 15 383 2.0E-12
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 77 384 2.0E-12
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 137 384 2.0E-12
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 150 384 2.0E-12
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 119 383 2.0E-12
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 77 383 2.0E-12
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 77 383 3.0E-12
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 77 384 3.0E-12
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 139 383 3.0E-12
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 77 384 4.0E-12
sp|Q9WUI1|MK11_MOUSE Mitogen-activated protein kinase 11 OS=Mus musculus GN=Mapk11 PE=1 SV=2 90 384 4.0E-12
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 137 385 4.0E-12
sp|Q40517|NTF3_TOBAC Mitogen-activated protein kinase homolog NTF3 OS=Nicotiana tabacum GN=NTF3 PE=1 SV=1 39 384 5.0E-12
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 14 383 5.0E-12
sp|Q40884|MPK_PETHY Mitogen-activated protein kinase homolog 1 OS=Petunia hybrida GN=MPK1 PE=2 SV=1 39 384 5.0E-12
sp|P0CP66|CPK1_CRYNJ Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPK1 PE=3 SV=1 137 383 6.0E-12
sp|P0CP67|CPK1_CRYNB Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPK1 PE=3 SV=1 137 383 6.0E-12
sp|Q6FQ83|BUR1_CANGA Serine/threonine-protein kinase BUR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BUR1 PE=3 SV=1 138 401 8.0E-12
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 15 392 9.0E-12
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 77 384 1.0E-11
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 77 384 1.0E-11
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 77 384 1.0E-11
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 77 384 1.0E-11
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 77 384 1.0E-11
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 71 383 1.0E-11
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 77 384 1.0E-11
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 71 383 1.0E-11
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 39 384 1.0E-11
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 80 290 2.0E-11
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 91 286 2.0E-11
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 119 383 2.0E-11
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 15 385 2.0E-11
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 77 396 2.0E-11
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 137 384 2.0E-11
sp|Q9I958|MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio GN=mapk14b PE=1 SV=1 77 384 2.0E-11
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 71 311 2.0E-11
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 91 286 2.0E-11
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 15 395 3.0E-11
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 77 384 3.0E-11
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 77 396 3.0E-11
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 77 396 4.0E-11
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 77 384 4.0E-11
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 143 393 4.0E-11
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 77 384 4.0E-11
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 15 384 4.0E-11
sp|A8XSC1|NLK_CAEBR Serine/threonine kinase NLK OS=Caenorhabditis briggsae GN=lit-1 PE=3 SV=2 137 383 5.0E-11
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 75 286 5.0E-11
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3 14 388 6.0E-11
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 80 290 8.0E-11
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 144 383 8.0E-11
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 71 383 9.0E-11
sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinase OS=Fusarium solani subsp. pisi GN=MAPK PE=2 SV=1 129 383 9.0E-11
sp|O23236|MPK14_ARATH Mitogen-activated protein kinase 14 OS=Arabidopsis thaliana GN=MPK14 PE=1 SV=1 77 383 9.0E-11
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 144 383 1.0E-10
sp|Q9WTY9|MK13_RAT Mitogen-activated protein kinase 13 OS=Rattus norvegicus GN=Mapk13 PE=1 SV=1 112 380 1.0E-10
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 15 297 1.0E-10
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabidopsis thaliana GN=ASK2 PE=2 SV=1 14 383 1.0E-10
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 91 286 1.0E-10
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 15 297 1.0E-10
sp|Q9Z1B7|MK13_MOUSE Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=1 SV=2 71 383 1.0E-10
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 13 383 2.0E-10
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 77 386 2.0E-10
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 91 293 2.0E-10
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2 144 380 2.0E-10
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 200 383 2.0E-10
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 15 297 2.0E-10
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 13 383 2.0E-10
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 75 286 2.0E-10
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 75 286 2.0E-10
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 200 383 2.0E-10
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 75 297 2.0E-10
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 75 297 2.0E-10
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 94 286 3.0E-10
sp|Q92398|SPM1_SCHPO Mitogen-activated protein kinase spm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm1 PE=1 SV=1 77 399 3.0E-10
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 91 290 4.0E-10
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 105 290 4.0E-10
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 144 388 5.0E-10
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 77 384 6.0E-10
sp|Q6CRA9|BUR1_KLULA Serine/threonine-protein kinase BUR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR1 PE=3 SV=1 13 398 6.0E-10
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 13 294 7.0E-10
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 13 393 8.0E-10
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 15 384 9.0E-10
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 15 384 9.0E-10
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 78 288 2.0E-09
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 107 287 2.0E-09
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 77 291 2.0E-09
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 77 291 2.0E-09
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 13 286 2.0E-09
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 107 287 4.0E-09
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 78 290 5.0E-09
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 15 287 5.0E-09
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 2 380 6.0E-09
sp|Q8MXI4|PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans GN=pmk-2 PE=3 SV=1 77 383 6.0E-09
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 13 395 7.0E-09
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 6 286 9.0E-09
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 13 383 9.0E-09
sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans GN=grk-1 PE=3 SV=1 89 286 1.0E-08
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 90 288 1.0E-08
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 89 286 1.0E-08
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 90 286 2.0E-08
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 201 380 2.0E-08
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 14 383 2.0E-08
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 110 291 3.0E-08
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 107 286 4.0E-08
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 89 286 4.0E-08
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 80 292 4.0E-08
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 107 286 7.0E-08
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 148 394 8.0E-08
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 201 383 1.0E-07
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 104 290 1.0E-07
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 14 305 1.0E-07
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 107 352 2.0E-07
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 75 312 2.0E-07
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 151 378 2.0E-07
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 75 286 2.0E-07
sp|O61847|CDK2_CAEEL Cyclin-dependent kinase 2 OS=Caenorhabditis elegans GN=cdk-2 PE=1 SV=2 2 389 2.0E-07
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 85 286 4.0E-07
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 103 286 5.0E-07
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 94 286 6.0E-07
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 107 286 6.0E-07
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 104 286 6.0E-07
sp|Q5Z754|CDKF1_ORYSJ Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. japonica GN=CDKF-1 PE=2 SV=1 247 384 6.0E-07
sp|A2YCH5|CDKF1_ORYSI Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. indica GN=CDKF-1 PE=3 SV=1 247 384 6.0E-07
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 200 380 7.0E-07
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 107 290 1.0E-06
sp|Q54V83|Y9296_DICDI Probable serine/threonine-protein kinase kinase DDB_G0280557 OS=Dictyostelium discoideum GN=DDB_G0280557 PE=3 SV=1 251 384 1.0E-06
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 105 286 3.0E-06
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 94 290 4.0E-06
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 110 286 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0030554 adenyl nucleotide binding No
GO:0016301 kinase activity No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0006793 phosphorus metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0019538 protein metabolic process No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3420
MRRLQKDFPGLRNSYRLIKRIGEGTFSTVFKAQDLRYNHYDNYWDVQNGSKWTPVPLNSKGEKDGSQRSPRRHPR
YVAIKKIYVTSSPTRILNELELLHALRRCPSVCPLITAFRQADQVIAVLPYFRHGDFRTYFRDMTSGDIAIYLRS
LFTALRSVHAHRILHRDIKPTNFLYDPYTQHGVLVDFGLAEREGSDTKPCLCHENRELRKHRFANSVWAQTASTI
ATQPRGYPKSDTRPARRANRAGTRGFRAPEVLFKCTEQTTAIDIWSVGVILLTILSKRFPFFNSSDDVEALIEIA
TIFGTRRMKAAALLHGCVFETSIPTIGQQGFSLDKIILWSTCRGDNRPLAPDEQLSIRFLERCLELDPTRRITAE
QALAHEFLAVDDFSSQELGDENEVDILEA*
Coding >OphauG2|3420
ATGCGAAGACTACAAAAGGATTTCCCTGGTCTACGCAACAGTTACCGCCTCATCAAGCGCATTGGCGAAGGCACT
TTTTCCACCGTGTTCAAAGCCCAAGACCTGCGCTACAACCACTACGATAACTATTGGGACGTTCAAAATGGCTCC
AAATGGACGCCTGTCCCCTTGAATAGCAAGGGGGAAAAGGATGGCTCGCAACGCTCGCCGCGCAGACACCCGCGG
TACGTGGCCATTAAAAAGATTTACGTCACCTCGAGCCCGACGCGCATCCTCAATGAACTCGAGCTTCTCCACGCG
CTTCGTCGCTGCCCTTCAGTCTGTCCCCTCATCACAGCCTTTCGTCAGGCCGACCAAGTCATTGCCGTGCTGCCT
TATTTCCGCCACGGCGATTTCCGCACATACTTTCGTGACATGACGTCGGGTGACATTGCCATCTATCTTCGCTCC
CTCTTCACGGCTCTGCGCAGTGTTCACGCCCATAGGATTCTGCATCGTGACATCAAGCCAACCAATTTTCTCTAC
GACCCATATACACAGCACGGCGTCTTGGTAGACTTTGGTCTTGCTGAGCGCGAGGGCTCCGACACGAAGCCCTGC
TTGTGCCACGAGAACCGCGAGCTGCGCAAGCATCGCTTCGCCAACTCTGTCTGGGCCCAAACCGCCTCCACAATT
GCTACTCAACCCCGTGGCTATCCAAAATCAGATACCCGCCCAGCTCGCCGCGCAAACCGCGCAGGCACCCGCGGT
TTCCGTGCCCCCGAAGTCTTGTTTAAATGCACCGAGCAAACTACTGCCATTGACATCTGGTCTGTTGGCGTCATT
CTTCTAACCATTTTATCCAAAAGGTTCCCCTTTTTCAACTCGAGTGACGACGTTGAAGCCCTTATTGAAATCGCC
ACCATTTTTGGCACCCGCCGCATGAAGGCTGCTGCTCTCCTCCACGGCTGTGTCTTTGAAACATCGATTCCAACA
ATTGGCCAACAGGGCTTTTCTCTCGACAAAATCATTCTTTGGAGCACGTGTCGTGGCGACAATAGGCCGCTCGCG
CCTGATGAGCAGTTGTCCATACGCTTTCTCGAGCGTTGTCTAGAGTTGGATCCCACTCGCCGCATAACGGCCGAA
CAAGCCCTGGCTCACGAATTCCTCGCCGTTGACGACTTCTCAAGCCAGGAATTGGGCGATGAAAACGAAGTGGAT
ATATTGGAGGCATAG
Transcript >OphauG2|3420
ATGCGAAGACTACAAAAGGATTTCCCTGGTCTACGCAACAGTTACCGCCTCATCAAGCGCATTGGCGAAGGCACT
TTTTCCACCGTGTTCAAAGCCCAAGACCTGCGCTACAACCACTACGATAACTATTGGGACGTTCAAAATGGCTCC
AAATGGACGCCTGTCCCCTTGAATAGCAAGGGGGAAAAGGATGGCTCGCAACGCTCGCCGCGCAGACACCCGCGG
TACGTGGCCATTAAAAAGATTTACGTCACCTCGAGCCCGACGCGCATCCTCAATGAACTCGAGCTTCTCCACGCG
CTTCGTCGCTGCCCTTCAGTCTGTCCCCTCATCACAGCCTTTCGTCAGGCCGACCAAGTCATTGCCGTGCTGCCT
TATTTCCGCCACGGCGATTTCCGCACATACTTTCGTGACATGACGTCGGGTGACATTGCCATCTATCTTCGCTCC
CTCTTCACGGCTCTGCGCAGTGTTCACGCCCATAGGATTCTGCATCGTGACATCAAGCCAACCAATTTTCTCTAC
GACCCATATACACAGCACGGCGTCTTGGTAGACTTTGGTCTTGCTGAGCGCGAGGGCTCCGACACGAAGCCCTGC
TTGTGCCACGAGAACCGCGAGCTGCGCAAGCATCGCTTCGCCAACTCTGTCTGGGCCCAAACCGCCTCCACAATT
GCTACTCAACCCCGTGGCTATCCAAAATCAGATACCCGCCCAGCTCGCCGCGCAAACCGCGCAGGCACCCGCGGT
TTCCGTGCCCCCGAAGTCTTGTTTAAATGCACCGAGCAAACTACTGCCATTGACATCTGGTCTGTTGGCGTCATT
CTTCTAACCATTTTATCCAAAAGGTTCCCCTTTTTCAACTCGAGTGACGACGTTGAAGCCCTTATTGAAATCGCC
ACCATTTTTGGCACCCGCCGCATGAAGGCTGCTGCTCTCCTCCACGGCTGTGTCTTTGAAACATCGATTCCAACA
ATTGGCCAACAGGGCTTTTCTCTCGACAAAATCATTCTTTGGAGCACGTGTCGTGGCGACAATAGGCCGCTCGCG
CCTGATGAGCAGTTGTCCATACGCTTTCTCGAGCGTTGTCTAGAGTTGGATCCCACTCGCCGCATAACGGCCGAA
CAAGCCCTGGCTCACGAATTCCTCGCCGTTGACGACTTCTCAAGCCAGGAATTGGGCGATGAAAACGAAGTGGAT
ATATTGGAGGCATAG
Gene >OphauG2|3420
ATGCGAAGACTACAAAAGGATTTCCCTGGTCTACGCAACAGTTACCGCCTCATCAAGCGCATTGGCGAAGGTTGG
CTCCCACCAAAGCTCCCCATCATTAGTCTCTCATCTAGCCAAGACTGATGTCATGCCTAGGCACTTTTTCCACCG
TGTTCAAAGCCCAAGACCTGCGCTACAACCACTACGATAACTATTGGGACGTTCAAAATGGCTCCAAATGGACGC
CTGTCCCCTTGAATAGCAAGGGGGAAAAGGATGGCTCGCAACGCTCGCCGCGCAGACACCCGCGGTACGTGGCCA
TTAAAAAGATTTACGTCACCTCGAGCCCGACGCGCATCCTCAATGAACTCGAGCTTCTCCACGCGCTTCGTCGCT
GCCCTTCAGTCTGTCCCCTCATCACAGCCTTTCGTCAGGCCGACCAAGTCATTGCCGTGCTGCCTTATTTCCGCC
ACGGCGATTTCCGCACATACTTTCGTGACATGACGTCGGGTGACATTGCCATCTATCTTCGCTCCCTCTTCACGG
CTCTGCGCAGTGTTCACGCCCATAGGATTCTGCATCGTGACATCAAGCCAACCAATTTTCTCTACGACCCATATA
CACAGCACGGCGTCTTGGTAGACTTTGGTCTTGCTGAGCGCGAGGGCTCCGACACGAAGCCCTGCTTGTGCCACG
AGAACCGCGAGCTGCGCAAGCATCGCTTCGCCAACTCTGTCTGGGCCCAAACCGCCTCCACAATTGCTACTCAAC
CCCGTGGCTATCCAAAATCAGATACCCGCCCAGCTCGCCGCGCAAACCGCGCAGGCACCCGCGGTTTCCGTGCCC
CCGAAGTCTTGTTTAAATGCACCGAGCAAACTACTGCCATTGACATCTGGTCTGTTGGCGTCATTCTTCTAACCA
TTTTATCCAAAAGGTTCCCCTTTTTCAACTCGAGTGACGACGTTGAAGCCCTTATTGAAATCGCCACCATTTTTG
GCACCCGCCGCATGAAGGCTGCTGCTCTCCTCCACGGCTGTGTCTTTGAAACATCGATTCCAACAATTGGCCAAC
AGGGCTTTTCTCTCGACAAAATCATTCTTTGGAGCACGTGTCGTGGCGACAATAGGCCGCTCGCGCCTGATGAGC
AGTTGTCCATACGCTTTCTCGAGCGTTGTCTAGAGTTGGATCCCACTCGCCGCATAACGGCCGAACAAGCCCTGG
CTCACGAATTCCTCGCCGTTGACGACTTCTCAAGCCAGGAATTGGGCGATGAAAACGAAGTGGATATATTGGAGG
CATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail