Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3419
Gene name
LocationContig_259:18747..19538
Strand+
Gene length (bp)791
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A 1.1E-16 28 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78987|RL27A_BLUGH 60S ribosomal protein L27a OS=Blumeria graminis f. sp. hordei PE=2 SV=1 1 150 3.0E-87
sp|P02406|RL28_YEAST 60S ribosomal protein L28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL28 PE=1 SV=3 1 150 4.0E-78
sp|P08978|RL28_NEUCR 60S ribosomal protein L28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-28 PE=2 SV=1 1 150 4.0E-77
sp|P57728|RL28B_SCHPO 60S ribosomal protein L28-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2801 PE=1 SV=1 1 150 1.0E-66
sp|P36585|RL28A_SCHPO 60S ribosomal protein L28-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2802 PE=3 SV=3 1 150 7.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78987|RL27A_BLUGH 60S ribosomal protein L27a OS=Blumeria graminis f. sp. hordei PE=2 SV=1 1 150 3.0E-87
sp|P02406|RL28_YEAST 60S ribosomal protein L28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL28 PE=1 SV=3 1 150 4.0E-78
sp|P08978|RL28_NEUCR 60S ribosomal protein L28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-28 PE=2 SV=1 1 150 4.0E-77
sp|P57728|RL28B_SCHPO 60S ribosomal protein L28-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2801 PE=1 SV=1 1 150 1.0E-66
sp|P36585|RL28A_SCHPO 60S ribosomal protein L28-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2802 PE=3 SV=3 1 150 7.0E-65
sp|P18445|RL27A_RAT 60S ribosomal protein L27a OS=Rattus norvegicus GN=Rpl27a PE=1 SV=3 1 150 8.0E-61
sp|P14115|RL27A_MOUSE 60S ribosomal protein L27a OS=Mus musculus GN=Rpl27a PE=1 SV=5 1 150 2.0E-60
sp|Q56K03|RL27A_BOVIN 60S ribosomal protein L27a OS=Bos taurus GN=RPL27A PE=2 SV=3 1 150 3.0E-60
sp|Q4R723|RL27A_MACFA 60S ribosomal protein L27a OS=Macaca fascicularis GN=RPL27A PE=2 SV=1 1 150 6.0E-60
sp|Q5REY2|RL27A_PONAB 60S ribosomal protein L27a OS=Pongo abelii GN=RPL27A PE=2 SV=3 1 150 7.0E-60
sp|P46776|RL27A_HUMAN 60S ribosomal protein L27a OS=Homo sapiens GN=RPL27A PE=1 SV=2 1 150 7.0E-60
sp|P49637|R27A3_ARATH 60S ribosomal protein L27a-3 OS=Arabidopsis thaliana GN=RPL27AC PE=2 SV=2 1 150 8.0E-60
sp|Q9LR33|R27A2_ARATH 60S ribosomal protein L27a-2 OS=Arabidopsis thaliana GN=RPL27AB PE=2 SV=1 1 150 4.0E-59
sp|Q5R1X0|RL27A_PANTR 60S ribosomal protein L27a OS=Pan troglodytes GN=RPL27A PE=2 SV=3 1 150 4.0E-59
sp|P41092|RL27A_DROME 60S ribosomal protein L27a OS=Drosophila melanogaster GN=RpL27A PE=1 SV=2 4 150 1.0E-58
sp|O01358|RL27A_OSCTI 60S ribosomal protein L27a OS=Oscheius tipulae GN=rpl-27a PE=3 SV=1 1 150 3.0E-58
sp|P47830|RL27A_XENLA 60S ribosomal protein L27a OS=Xenopus laevis GN=rpl27a PE=2 SV=2 1 150 2.0E-57
sp|P48160|RL27A_DICDI 60S ribosomal protein L27a OS=Dictyostelium discoideum GN=rpl27a PE=3 SV=1 1 150 3.0E-53
sp|O15883|RL27A_TRYBB 60S ribosomal protein L27a OS=Trypanosoma brucei brucei GN=RPL27A PE=2 SV=1 1 150 8.0E-53
sp|P48161|RL27A_EUPCR 60S ribosomal protein L27a OS=Euplotes crassus GN=RPL27A PE=3 SV=1 1 150 6.0E-51
sp|Q27021|RL27A_TENMO 60S ribosomal protein L27a OS=Tenebrio molitor GN=RpL27A PE=2 SV=1 1 150 2.0E-50
sp|Q9BI14|R27A3_ENTHI 60S ribosomal protein L27a-3 OS=Entamoeba histolytica GN=rpl27a-3 PE=3 SV=1 13 150 2.0E-44
sp|Q00454|RL27A_TETTH 60S ribosomal protein L27a OS=Tetrahymena thermophila GN=RPL27A PE=1 SV=1 1 150 7.0E-44
sp|Q9BH80|R27A2_ENTHI 60S ribosomal protein L27a-2/4 OS=Entamoeba histolytica GN=rpl27a-2 PE=3 SV=1 13 150 2.0E-43
sp|Q9BI06|R27A1_ENTHI 60S ribosomal protein L27a-1 OS=Entamoeba histolytica GN=rpl27a-1 PE=3 SV=1 13 150 3.0E-43
sp|O62581|RL27A_ENCCU 60S ribosomal protein L27a OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL27A PE=3 SV=1 1 144 3.0E-38
sp|Q9LPV3|R27A1_ARATH Putative 60S ribosomal protein L27a-1 OS=Arabidopsis thaliana GN=RPL27AA PE=5 SV=1 1 148 1.0E-23
sp|Q29333|RL27A_PIG 60S ribosomal protein L27a (Fragment) OS=Sus scrofa GN=RPL27A PE=2 SV=3 1 54 6.0E-23
sp|A6UWW0|RL15_META3 50S ribosomal protein L15 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl15 PE=3 SV=1 1 148 1.0E-14
sp|P54047|RL15_METJA 50S ribosomal protein L15 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl15 PE=3 SV=1 11 148 1.0E-13
sp|P47831|RL28_CANAX 60S ribosomal protein L28 (Fragment) OS=Candida albicans GN=RPL28 PE=2 SV=1 85 138 6.0E-12
sp|B8D5U8|RL15_DESK1 50S ribosomal protein L15 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl15 PE=3 SV=1 7 149 2.0E-11
sp|O26133|RL15_METTH 50S ribosomal protein L15 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl15 PE=3 SV=1 35 149 3.0E-11
sp|A1RWR4|RL15_THEPD 50S ribosomal protein L15 OS=Thermofilum pendens (strain Hrk 5) GN=rpl15 PE=3 SV=1 4 149 8.0E-11
sp|Q2NFX9|RL15_METST 50S ribosomal protein L15 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl15 PE=3 SV=1 1 149 3.0E-10
sp|A4FVT7|RL15_METM5 50S ribosomal protein L15 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl15 PE=3 SV=1 1 148 1.0E-09
sp|A2BME1|RL15_HYPBU 50S ribosomal protein L15 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl15 PE=3 SV=1 4 149 2.0E-09
sp|A1RT57|RL15_PYRIL 50S ribosomal protein L15 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl15 PE=3 SV=1 12 149 3.0E-09
sp|A6UQ66|RL15_METVS 50S ribosomal protein L15 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl15 PE=3 SV=1 1 148 5.0E-09
sp|P14032|RL15_METVA 50S ribosomal protein L15 OS=Methanococcus vannielii GN=rpl15 PE=3 SV=1 1 148 5.0E-09
sp|A6VH07|RL15_METM7 50S ribosomal protein L15 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl15 PE=3 SV=1 1 148 5.0E-09
sp|A9A9P2|RL15_METM6 50S ribosomal protein L15 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl15 PE=3 SV=1 1 148 1.0E-08
sp|O05643|RL15_SULAC 50S ribosomal protein L15 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl15 PE=3 SV=1 4 150 2.0E-08
sp|A3DNC9|RL15_STAMF 50S ribosomal protein L15 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl15 PE=3 SV=1 16 150 4.0E-08
sp|Q9UX85|RL15_SULSO 50S ribosomal protein L15 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl15 PE=3 SV=1 4 148 5.0E-08
sp|Q6LXD1|RL15_METMP 50S ribosomal protein L15 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl15 PE=3 SV=1 1 148 3.0E-07
sp|A3MUZ1|RL15_PYRCJ 50S ribosomal protein L15 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl15 PE=3 SV=1 8 150 1.0E-06
sp|A4WM07|RL15_PYRAR 50S ribosomal protein L15 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl15 PE=3 SV=1 12 150 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3419
MPTRTSKTRKLRGHVSHGHGRIGKHRKHPGGRGLAGGQHHHRTNMDKYHPGYFGKVGMRYFHKQQNHFWKPVINL
DKLWTLVPAETREAYISGSKKKDTVPVLDLLPFGYSKVLGKGRIPQIPLVVRARWVSKLAEKKITEAGGVVELVA
*
Coding >OphauG2|3419
ATGCCTACCCGAACCTCCAAAACCCGCAAGCTTCGCGGCCACGTCTCACACGGCCACGGCCGTATCGGCAAGCAT
CGCAAGCATCCCGGTGGTCGCGGTCTGGCTGGTGGCCAGCATCACCACCGCACCAATATGGACAAGTACCATCCT
GGTTACTTTGGCAAGGTTGGCATGCGATATTTTCACAAGCAACAAAACCACTTCTGGAAGCCTGTGATCAACCTG
GACAAGTTGTGGACTCTCGTACCTGCCGAGACACGCGAAGCCTACATTTCAGGTTCAAAAAAGAAGGACACAGTC
CCTGTCCTTGACCTCCTGCCTTTTGGCTACTCCAAGGTCCTCGGCAAAGGCCGCATTCCCCAAATTCCCCTGGTC
GTACGCGCCAGATGGGTCAGCAAGCTGGCAGAGAAGAAGATCACCGAGGCCGGCGGCGTGGTCGAACTGGTGGCA
TAG
Transcript >OphauG2|3419
ATGCCTACCCGAACCTCCAAAACCCGCAAGCTTCGCGGCCACGTCTCACACGGCCACGGCCGTATCGGCAAGCAT
CGCAAGCATCCCGGTGGTCGCGGTCTGGCTGGTGGCCAGCATCACCACCGCACCAATATGGACAAGTACCATCCT
GGTTACTTTGGCAAGGTTGGCATGCGATATTTTCACAAGCAACAAAACCACTTCTGGAAGCCTGTGATCAACCTG
GACAAGTTGTGGACTCTCGTACCTGCCGAGACACGCGAAGCCTACATTTCAGGTTCAAAAAAGAAGGACACAGTC
CCTGTCCTTGACCTCCTGCCTTTTGGCTACTCCAAGGTCCTCGGCAAAGGCCGCATTCCCCAAATTCCCCTGGTC
GTACGCGCCAGATGGGTCAGCAAGCTGGCAGAGAAGAAGATCACCGAGGCCGGCGGCGTGGTCGAACTGGTGGCA
TAG
Gene >OphauG2|3419
ATGCCTACCCGAACCTCCAAAACCCGCAAGCTGTACGTTGTGCCCAAATTCGATCGATCCCGGAGCGCAAACTGC
TCCTAATTGTTGCGAGCTGCCGAGACACCAGAGCGGCGTCAATGGGGCAACATGGAATTCGAAACTAATATTCTT
CTTCTCACCATAGTCGCGGCCACGTCTCACACGGCCACGGCCGTATCGGCAAGCATCGCAAGCATCCCGGTGGTC
GCGGTCTGGCTGGTGGCCAGCATCACCACCGCACCAATATGGACAAGGTTCGACACGATGGAATAAGATAGCAAG
AAACGGGCACCCACATACTGACGCTCTGGCAACAGTACCATCCTGGTTACTTTGGCAAGGTTGGCATGCGATATT
TTCACAAGCAACAAAACCACTTCTGGAAGCCTGTGATCAACCTGGACAAGGTACACTACATTTTTCATTTACCCA
GTCCATTGTTCTTGGCTACCCCATCTCGAGTACCATTGTCGAGCTACTCCTCACTCGTGCCGATTGCCAATATTC
GATTATGCACTCTTATCGAATGGCTTGCTGATTCTCAATTCCAGTTGTGGACTCTCGTACCTGCCGAGACACGCG
AAGCCTACATTTCAGGTTCAAAAAAGAAGGACACAGTCCCTGTCCTTGACCTCCTGCCTTTTGGCTACTCCAAGG
TCCTCGGCAAAGGCCGCATTCCCCAAATTCCCCTGGTCGTACGCGCCAGATGGGTCAGCAAGCTGGCAGAGAAGA
AGATCACCGAGGCCGGCGGCGTGGTCGAACTGGTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail