Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3392
Gene name
LocationContig_256:16682..19255
Strand-
Gene length (bp)2573
Transcript length (bp)2451
Coding sequence length (bp)2451
Protein length (aa) 817

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19343 DUF5923 Family of unknown function (DUF5923) 5.6E-249 3 612
PF14613 DUF4449 Protein of unknown function (DUF4449) 4.8E-65 625 787

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10327|YD72_SCHPO Uncharacterized protein C32A11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC32A11.02c PE=4 SV=1 8 797 3.0E-76

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3392
MTANVNKPTDTKLKEADINRKLQLYGIVTAFKLGKVPSNDQIDVALNSFLQSKALNSPSSKLSDDGKTLVQDTRE
VVKLAKNLVLSKNEGNLIQDFIWQTTQFDTKSIKGPERPIDKDTAKRDGDEALQGLRTLGTLLITNGQFRKLLKD
STVLLRDMAGDAATSAAGRVRPSENDLSQLDQAAPDNTWHEAPDFSKESLKKQAHGFYGGNPKADAKDVVDAGAN
AAAPPAGTNDPAAVDATAGQNAGLEAAKDKIDQNTDPETKEKIKQRNEEYRRRAHEYFDKKMPKERKDQIIFRLK
KMVLECQQHPDYSQAIQALLRLAETYGQHGSTLGKGSAGSAKQARTGFAAAETDLRTLLERFANGTSTSDLWGSI
QQIYKEADKDQELRGWFKSMNNYIRRSLLEQGYILDKASTKEWDRLYEHGRYLLRDKYRGQTNDVIDEAKFIAEQ
FEHDSQNKAFGQAVEKLFNHLGTDANGKGAFKPHLLKDLGDVILPAALESINYIPVPRIEYSDPQFDAIIENLVL
ESDNFMPNVFEVSSENFFRWGRKKLGNKNHNVMDVKVAGIQMDLRDVSYHVKRKSGFPSITDTGVADILLPGNGF
SFRMKVSSAHKGDTNHIFKVDKVDVDFKGLNIKLKQSNHKLLFGIVKPLMLKVLRPPIQMAVEKAIKDQCNKLDG
ELYEIKKEADRTGQQARAGSESHASFYQRYYQAAQKRFMDGKEQKKKHASEASHDKKVNVAMTMEDSIFPNITLP
GGVSSKASEYKELAHKGEKWESPVFSIGSASKSTDVPAAPRIEKRTRPVTNGVGKAVNGQTVLGAL*
Coding >OphauG2|3392
ATGACAGCCAACGTCAATAAACCCACTGATACCAAGCTCAAGGAGGCCGACATCAATCGCAAACTCCAACTTTAC
GGCATTGTCACCGCATTCAAGCTCGGCAAGGTCCCTTCGAATGATCAGATTGATGTCGCTCTCAATAGCTTCCTC
CAATCCAAGGCACTCAATAGCCCTTCGTCAAAGCTGTCTGACGATGGCAAGACGCTTGTTCAAGACACGAGAGAG
GTGGTCAAGCTGGCCAAGAATCTTGTCCTGTCCAAGAACGAAGGCAATTTGATTCAAGATTTTATCTGGCAAACT
ACACAATTTGACACCAAGAGCATCAAGGGCCCTGAACGCCCCATTGATAAGGACACTGCGAAGCGTGATGGCGAC
GAGGCTCTCCAGGGCCTTCGCACCCTTGGTACTCTGCTCATCACCAATGGCCAGTTCCGCAAGCTGCTCAAGGAC
TCGACCGTTCTTCTCCGCGACATGGCTGGTGATGCCGCTACCAGCGCTGCCGGACGTGTTCGCCCTTCGGAAAAC
GATCTTAGCCAGCTGGACCAAGCTGCTCCTGACAACACGTGGCATGAGGCCCCAGACTTCTCCAAGGAAAGTCTA
AAGAAGCAAGCCCACGGCTTTTATGGTGGAAACCCCAAGGCCGACGCCAAGGATGTTGTTGACGCAGGAGCCAAC
GCTGCAGCTCCTCCTGCTGGAACCAATGACCCTGCCGCTGTCGATGCAACTGCGGGTCAGAATGCAGGCCTTGAA
GCCGCCAAGGACAAGATTGACCAGAATACCGACCCCGAGACCAAGGAAAAGATCAAGCAGCGCAACGAGGAATAT
CGTCGTCGGGCCCATGAATACTTTGACAAGAAGATGCCCAAGGAGCGCAAGGATCAAATCATCTTCCGCCTCAAA
AAGATGGTTCTTGAATGCCAGCAACACCCCGACTACTCTCAAGCTATTCAGGCCCTGCTTCGCTTGGCCGAGACG
TATGGCCAGCATGGCAGCACCCTGGGCAAGGGCTCAGCGGGCTCGGCCAAGCAGGCTCGCACTGGCTTTGCCGCT
GCCGAGACTGACCTGCGCACTCTGCTTGAGCGCTTTGCTAATGGCACCTCGACGTCTGACTTGTGGGGCTCCATT
CAACAGATTTATAAGGAGGCGGACAAGGACCAGGAGCTCCGTGGCTGGTTCAAGAGCATGAACAATTATATTCGC
CGCTCTCTGCTCGAGCAGGGTTACATTCTTGACAAGGCATCAACCAAGGAATGGGACCGCTTGTATGAGCACGGC
CGATATTTGCTCCGCGACAAGTACCGTGGCCAGACCAATGATGTCATTGACGAGGCCAAGTTTATTGCTGAGCAG
TTTGAACATGATTCCCAAAACAAGGCCTTTGGACAAGCGGTGGAGAAGCTCTTCAACCACTTGGGCACGGATGCC
AACGGCAAGGGCGCCTTCAAGCCTCATTTGCTCAAGGACTTGGGAGACGTTATTTTGCCAGCGGCCCTGGAAAGC
ATCAATTACATTCCCGTTCCGCGCATAGAGTACTCGGATCCTCAGTTCGATGCTATTATTGAAAACCTCGTTCTC
GAGAGCGACAACTTTATGCCCAATGTTTTTGAGGTGTCGAGCGAAAACTTTTTCCGCTGGGGCCGCAAGAAGCTT
GGCAACAAGAACCACAATGTCATGGATGTCAAGGTTGCTGGCATTCAGATGGACCTGCGTGATGTCAGCTACCAC
GTGAAGCGCAAGAGTGGCTTCCCTTCGATTACTGACACTGGTGTGGCGGATATTTTGCTTCCTGGAAACGGCTTC
TCGTTCCGCATGAAGGTGTCGTCGGCGCACAAGGGCGACACAAACCACATCTTCAAGGTGGACAAGGTGGATGTT
GACTTCAAGGGTCTCAACATCAAACTCAAGCAGTCGAACCACAAGCTCTTGTTTGGAATTGTCAAGCCGCTGATG
CTCAAGGTTTTGCGCCCGCCGATTCAAATGGCTGTGGAAAAGGCCATCAAGGACCAGTGTAACAAGCTGGACGGG
GAGCTGTACGAAATCAAGAAGGAAGCGGACCGCACAGGCCAACAGGCGCGGGCTGGCTCGGAAAGCCATGCTAGT
TTCTACCAGCGGTACTACCAGGCCGCGCAGAAGCGCTTTATGGACGGCAAGGAGCAAAAGAAGAAGCACGCGAGC
GAGGCGTCGCACGACAAGAAGGTGAATGTTGCCATGACGATGGAGGACAGCATCTTCCCCAACATTACGCTGCCC
GGCGGAGTCAGCTCCAAGGCTAGTGAATACAAGGAGCTGGCACACAAGGGTGAGAAGTGGGAGAGCCCCGTCTTT
TCGATTGGCAGCGCCAGCAAGAGCACGGATGTGCCAGCAGCCCCTCGCATTGAGAAGCGGACCCGGCCTGTGACG
AATGGCGTGGGCAAGGCGGTCAATGGACAGACTGTTCTGGGAGCCCTCTAG
Transcript >OphauG2|3392
ATGACAGCCAACGTCAATAAACCCACTGATACCAAGCTCAAGGAGGCCGACATCAATCGCAAACTCCAACTTTAC
GGCATTGTCACCGCATTCAAGCTCGGCAAGGTCCCTTCGAATGATCAGATTGATGTCGCTCTCAATAGCTTCCTC
CAATCCAAGGCACTCAATAGCCCTTCGTCAAAGCTGTCTGACGATGGCAAGACGCTTGTTCAAGACACGAGAGAG
GTGGTCAAGCTGGCCAAGAATCTTGTCCTGTCCAAGAACGAAGGCAATTTGATTCAAGATTTTATCTGGCAAACT
ACACAATTTGACACCAAGAGCATCAAGGGCCCTGAACGCCCCATTGATAAGGACACTGCGAAGCGTGATGGCGAC
GAGGCTCTCCAGGGCCTTCGCACCCTTGGTACTCTGCTCATCACCAATGGCCAGTTCCGCAAGCTGCTCAAGGAC
TCGACCGTTCTTCTCCGCGACATGGCTGGTGATGCCGCTACCAGCGCTGCCGGACGTGTTCGCCCTTCGGAAAAC
GATCTTAGCCAGCTGGACCAAGCTGCTCCTGACAACACGTGGCATGAGGCCCCAGACTTCTCCAAGGAAAGTCTA
AAGAAGCAAGCCCACGGCTTTTATGGTGGAAACCCCAAGGCCGACGCCAAGGATGTTGTTGACGCAGGAGCCAAC
GCTGCAGCTCCTCCTGCTGGAACCAATGACCCTGCCGCTGTCGATGCAACTGCGGGTCAGAATGCAGGCCTTGAA
GCCGCCAAGGACAAGATTGACCAGAATACCGACCCCGAGACCAAGGAAAAGATCAAGCAGCGCAACGAGGAATAT
CGTCGTCGGGCCCATGAATACTTTGACAAGAAGATGCCCAAGGAGCGCAAGGATCAAATCATCTTCCGCCTCAAA
AAGATGGTTCTTGAATGCCAGCAACACCCCGACTACTCTCAAGCTATTCAGGCCCTGCTTCGCTTGGCCGAGACG
TATGGCCAGCATGGCAGCACCCTGGGCAAGGGCTCAGCGGGCTCGGCCAAGCAGGCTCGCACTGGCTTTGCCGCT
GCCGAGACTGACCTGCGCACTCTGCTTGAGCGCTTTGCTAATGGCACCTCGACGTCTGACTTGTGGGGCTCCATT
CAACAGATTTATAAGGAGGCGGACAAGGACCAGGAGCTCCGTGGCTGGTTCAAGAGCATGAACAATTATATTCGC
CGCTCTCTGCTCGAGCAGGGTTACATTCTTGACAAGGCATCAACCAAGGAATGGGACCGCTTGTATGAGCACGGC
CGATATTTGCTCCGCGACAAGTACCGTGGCCAGACCAATGATGTCATTGACGAGGCCAAGTTTATTGCTGAGCAG
TTTGAACATGATTCCCAAAACAAGGCCTTTGGACAAGCGGTGGAGAAGCTCTTCAACCACTTGGGCACGGATGCC
AACGGCAAGGGCGCCTTCAAGCCTCATTTGCTCAAGGACTTGGGAGACGTTATTTTGCCAGCGGCCCTGGAAAGC
ATCAATTACATTCCCGTTCCGCGCATAGAGTACTCGGATCCTCAGTTCGATGCTATTATTGAAAACCTCGTTCTC
GAGAGCGACAACTTTATGCCCAATGTTTTTGAGGTGTCGAGCGAAAACTTTTTCCGCTGGGGCCGCAAGAAGCTT
GGCAACAAGAACCACAATGTCATGGATGTCAAGGTTGCTGGCATTCAGATGGACCTGCGTGATGTCAGCTACCAC
GTGAAGCGCAAGAGTGGCTTCCCTTCGATTACTGACACTGGTGTGGCGGATATTTTGCTTCCTGGAAACGGCTTC
TCGTTCCGCATGAAGGTGTCGTCGGCGCACAAGGGCGACACAAACCACATCTTCAAGGTGGACAAGGTGGATGTT
GACTTCAAGGGTCTCAACATCAAACTCAAGCAGTCGAACCACAAGCTCTTGTTTGGAATTGTCAAGCCGCTGATG
CTCAAGGTTTTGCGCCCGCCGATTCAAATGGCTGTGGAAAAGGCCATCAAGGACCAGTGTAACAAGCTGGACGGG
GAGCTGTACGAAATCAAGAAGGAAGCGGACCGCACAGGCCAACAGGCGCGGGCTGGCTCGGAAAGCCATGCTAGT
TTCTACCAGCGGTACTACCAGGCCGCGCAGAAGCGCTTTATGGACGGCAAGGAGCAAAAGAAGAAGCACGCGAGC
GAGGCGTCGCACGACAAGAAGGTGAATGTTGCCATGACGATGGAGGACAGCATCTTCCCCAACATTACGCTGCCC
GGCGGAGTCAGCTCCAAGGCTAGTGAATACAAGGAGCTGGCACACAAGGGTGAGAAGTGGGAGAGCCCCGTCTTT
TCGATTGGCAGCGCCAGCAAGAGCACGGATGTGCCAGCAGCCCCTCGCATTGAGAAGCGGACCCGGCCTGTGACG
AATGGCGTGGGCAAGGCGGTCAATGGACAGACTGTTCTGGGAGCCCTCTAG
Gene >OphauG2|3392
ATGACAGCCAACGTCAATAAACCCACTGATACCAAGCTCAAGGAGGCCGACATCAATCGCAAACTCCAACTTTAC
GGCATTGTCACCGCATTCAAGCTCGGCAAGGTCCCTTCGGTAAGTCTGCTACCTTGTCTTGCCCTGAAACGCCCC
AATTACTGATGCAATTTGTCTCTTCTCCAGAATGATCAGATTGATGTCGCTCTCAATAGCTTCCTCCAATCCAAG
GCACTCAATAGCCCTTCGTCAAAGCTGTCTGACGATGGCAAGACGCTTGTTCAAGACACGAGAGAGGTGGTCAAG
CTGGCCAAGAATCTTGTCCTGTCCAAGAACGAAGGCAATTTGATTCAAGATTTTATCTGGCAAACTACACAATTT
GACACCAAGAGCATCAAGGGCCCTGAACGCCCCATTGATAAGGACACTGCGAAGCGTGATGGCGACGAGGCTCTC
CAGGGCCTTCGCACCCTTGGTACTCTGCTCATCACCAATGGCCAGTTCCGCAAGCTGCGTATGTCTTGGTCAAGC
ATTTTGTATTTTGCCCAACCCTGCTGACGCTTTTTATAGTCAAGGACTCGACCGTTCTTCTCCGCGACATGGCTG
GTGATGCCGCTACCAGCGCTGCCGGACGTGTTCGCCCTTCGGAAAACGATCTTAGCCAGCTGGACCAAGCTGCTC
CTGACAACACGTGGCATGAGGCCCCAGACTTCTCCAAGGAAAGTCTAAAGAAGCAAGCCCACGGCTTTTATGGTG
GAAACCCCAAGGCCGACGCCAAGGATGTTGTTGACGCAGGAGCCAACGCTGCAGCTCCTCCTGCTGGAACCAATG
ACCCTGCCGCTGTCGATGCAACTGCGGGTCAGAATGCAGGCCTTGAAGCCGCCAAGGACAAGATTGACCAGAATA
CCGACCCCGAGACCAAGGAAAAGATCAAGCAGCGCAACGAGGAATATCGTCGTCGGGCCCATGAATACTTTGACA
AGAAGATGCCCAAGGAGCGCAAGGATCAAATCATCTTCCGCCTCAAAAAGATGGTTCTTGAATGCCAGCAACACC
CCGACTACTCTCAAGCTATTCAGGCCCTGCTTCGCTTGGCCGAGACGTATGGCCAGCATGGCAGCACCCTGGGCA
AGGGCTCAGCGGGCTCGGCCAAGCAGGCTCGCACTGGCTTTGCCGCTGCCGAGACTGACCTGCGCACTCTGCTTG
AGCGCTTTGCTAATGGCACCTCGACGTCTGACTTGTGGGGCTCCATTCAACAGATTTATAAGGAGGCGGACAAGG
ACCAGGAGCTCCGTGGCTGGTTCAAGAGCATGAACAATTATATTCGCCGCTCTCTGCTCGAGCAGGGTTACATTC
TTGACAAGGCATCAACCAAGGAATGGGACCGCTTGTATGAGCACGGCCGATATTTGCTCCGCGACAAGTACCGTG
GCCAGACCAATGATGTCATTGACGAGGCCAAGTTTATTGCTGAGCAGTTTGAACATGATTCCCAAAACAAGGCCT
TTGGACAAGCGGTGGAGAAGCTCTTCAACCACTTGGGCACGGATGCCAACGGCAAGGGCGCCTTCAAGCCTCATT
TGCTCAAGGACTTGGGAGACGTTATTTTGCCAGCGGCCCTGGAAAGCATCAATTACATTCCCGTTCCGCGCATAG
AGTACTCGGATCCTCAGTTCGATGCTATTATTGAAAACCTCGTTCTCGAGAGCGACAACTTTATGCCCAATGTTT
TTGAGGTGTCGAGCGAAAACTTTTTCCGCTGGGGCCGCAAGAAGCTTGGCAACAAGAACCACAATGTCATGGATG
TCAAGGTTGCTGGCATTCAGATGGACCTGCGTGATGTCAGCTACCACGTGAAGCGCAAGAGTGGCTTCCCTTCGA
TTACTGACACTGGTGTGGCGGATATTTTGCTTCCTGGAAACGGCTTCTCGTTCCGCATGAAGGTGTCGTCGGCGC
ACAAGGGCGACACAAACCACATCTTCAAGGTGGACAAGGTGGATGTTGACTTCAAGGGTCTCAACATCAAACTCA
AGCAGTCGAACCACAAGCTCTTGTTTGGAATTGTCAAGCCGCTGATGCTCAAGGTTTTGCGCCCGCCGATTCAAA
TGGCTGTGGAAAAGGCCATCAAGGACCAGTGTAACAAGCTGGACGGGGAGCTGTACGAAATCAAGAAGGAAGCGG
ACCGCACAGGCCAACAGGCGCGGGCTGGCTCGGAAAGCCATGCTAGTTTCTACCAGCGGTACTACCAGGCCGCGC
AGAAGCGCTTTATGGACGGCAAGGAGCAAAAGAAGAAGCACGCGAGCGAGGCGTCGCACGACAAGAAGGTGAATG
TTGCCATGACGATGGAGGACAGCATCTTCCCCAACATTACGCTGCCCGGCGGAGTCAGCTCCAAGGCTAGTGAAT
ACAAGGAGCTGGCACACAAGGGTGAGAAGTGGGAGAGCCCCGTCTTTTCGATTGGCAGCGCCAGCAAGAGCACGG
ATGTGCCAGCAGCCCCTCGCATTGAGAAGCGGACCCGGCCTGTGACGAATGGCGTGGGCAAGGCGGTCAATGGAC
AGACTGTTCTGGGAGCCCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail