Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3387
Gene name
LocationContig_256:4524..6036
Strand+
Gene length (bp)1512
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12519 MDM10 Mitochondrial distribution and morphology protein 10 9.8E-149 1 472

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBE0|MDM10_NEUCR Mitochondrial distribution and morphology protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm10 PE=3 SV=4 1 472 6.0E-157
sp|Q2H740|MDM10_CHAGB Mitochondrial distribution and morphology protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM10 PE=3 SV=2 1 450 3.0E-153
sp|O13498|MDM10_PODAN Mitochondrial distribution and morphology protein 10 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM10 PE=3 SV=1 1 472 8.0E-148
sp|A4QTI8|MDM10_MAGO7 Mitochondrial distribution and morphology protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM10 PE=3 SV=1 1 472 4.0E-134
sp|A7F1G7|MDM10_SCLS1 Mitochondrial distribution and morphology protein 10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm10 PE=3 SV=1 1 472 4.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBE0|MDM10_NEUCR Mitochondrial distribution and morphology protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm10 PE=3 SV=4 1 472 6.0E-157
sp|Q2H740|MDM10_CHAGB Mitochondrial distribution and morphology protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM10 PE=3 SV=2 1 450 3.0E-153
sp|O13498|MDM10_PODAN Mitochondrial distribution and morphology protein 10 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM10 PE=3 SV=1 1 472 8.0E-148
sp|A4QTI8|MDM10_MAGO7 Mitochondrial distribution and morphology protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM10 PE=3 SV=1 1 472 4.0E-134
sp|A7F1G7|MDM10_SCLS1 Mitochondrial distribution and morphology protein 10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm10 PE=3 SV=1 1 472 4.0E-133
sp|Q0TWV0|MDM10_PHANO Mitochondrial distribution and morphology protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDM10 PE=3 SV=1 1 332 9.0E-95
sp|C1GVA2|MDM10_PARBA Mitochondrial distribution and morphology protein 10 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MDM10 PE=3 SV=3 1 449 9.0E-65
sp|Q6CAG4|MDM10_YARLI Mitochondrial distribution and morphology protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM10 PE=3 SV=1 1 331 1.0E-62
sp|Q0CJH2|MDM10_ASPTN Mitochondrial distribution and morphology protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdmB PE=3 SV=1 1 449 3.0E-60
sp|A1DDI7|MDM10_NEOFI Mitochondrial distribution and morphology protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdmB PE=3 SV=1 1 449 6.0E-60
sp|B0Y240|MDM10_ASPFC Mitochondrial distribution and morphology protein 10 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mdmB PE=3 SV=1 1 462 8.0E-60
sp|A6QYP4|MDM10_AJECN Mitochondrial distribution and morphology protein 10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MDM10 PE=3 SV=1 1 449 1.0E-59
sp|C0NFC2|MDM10_AJECG Mitochondrial distribution and morphology protein 10 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MDM10 PE=3 SV=1 1 449 6.0E-59
sp|C4JV00|MDM10_UNCRE Mitochondrial distribution and morphology protein 10 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MDM10 PE=3 SV=1 1 449 2.0E-58
sp|Q4WVV6|MDM10_ASPFU Mitochondrial distribution and morphology protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdmB PE=3 SV=1 1 462 3.0E-57
sp|A1CBT0|MDM10_ASPCL Mitochondrial distribution and morphology protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdmB PE=3 SV=1 1 449 8.0E-57
sp|A2R3N6|MDM10_ASPNC Mitochondrial distribution and morphology protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdmB PE=3 SV=1 1 471 1.0E-56
sp|B8NM08|MDM10_ASPFN Mitochondrial distribution and morphology protein 10 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mdmB PE=3 SV=1 1 449 5.0E-56
sp|Q2U5V7|MDM10_ASPOR Mitochondrial distribution and morphology protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdmB PE=3 SV=1 1 449 2.0E-55
sp|C5GL32|MDM10_AJEDR Mitochondrial distribution and morphology protein 10 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MDM10 PE=3 SV=1 1 449 3.0E-55
sp|C5K0G3|MDM10_AJEDS Mitochondrial distribution and morphology protein 10 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MDM10 PE=3 SV=1 1 449 3.0E-55
sp|Q1DK03|MDM10_COCIM Mitochondrial distribution and morphology protein 10 OS=Coccidioides immitis (strain RS) GN=MDM10 PE=3 SV=1 1 449 5.0E-55
sp|B6HL48|MDM10_PENRW Mitochondrial distribution and morphology protein 10 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mdm10 PE=3 SV=1 1 449 3.0E-54
sp|B6Q6B6|MDM10_TALMQ Mitochondrial distribution and morphology protein 10 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mdm10 PE=3 SV=1 1 452 3.0E-54
sp|B9WBE5|MDM10_CANDC Mitochondrial distribution and morphology protein 10 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MDM10 PE=3 SV=1 1 471 4.0E-52
sp|Q8J0L4|MDM10_EMENI Mitochondrial distribution and morphology protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdmB PE=3 SV=1 1 449 6.0E-51
sp|B8LYF6|MDM10_TALSN Mitochondrial distribution and morphology protein 10 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mdm10 PE=3 SV=1 1 452 1.0E-50
sp|C5DG70|MDM10_LACTC Mitochondrial distribution and morphology protein 10 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MDM10 PE=3 SV=1 1 460 3.0E-49
sp|Q6BTX9|MDM10_DEBHA Mitochondrial distribution and morphology protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MDM10 PE=3 SV=2 1 329 1.0E-48
sp|A8NWS6|MDM10_COPC7 Mitochondrial distribution and morphology protein 10 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MDM10 PE=3 SV=1 1 472 6.0E-48
sp|C5M6Z4|MDM10_CANTT Mitochondrial distribution and morphology protein 10 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MDM10 PE=3 SV=1 1 471 7.0E-48
sp|C4XVQ6|MDM10_CLAL4 Mitochondrial distribution and morphology protein 10 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MDM10 PE=3 SV=1 1 464 8.0E-48
sp|A3LT10|MDM10_PICST Mitochondrial distribution and morphology protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MDM10 PE=3 SV=2 1 455 7.0E-47
sp|P0CO66|MDM10_CRYNJ Mitochondrial distribution and morphology protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDM10 PE=3 SV=1 1 472 8.0E-47
sp|P0CO67|MDM10_CRYNB Mitochondrial distribution and morphology protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDM10 PE=3 SV=1 1 472 2.0E-46
sp|Q59LL4|MDM10_CANAL Mitochondrial distribution and morphology protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM10 PE=3 SV=1 1 330 6.0E-46
sp|O13814|MDM10_SCHPO Mitochondrial distribution and morphology protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm10 PE=1 SV=1 1 331 1.0E-45
sp|C4YIG3|MDM10_CANAW Mitochondrial distribution and morphology protein 10 OS=Candida albicans (strain WO-1) GN=MDM10 PE=3 SV=1 1 330 5.0E-45
sp|A5DUG6|MDM10_LODEL Mitochondrial distribution and morphology protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MDM10 PE=3 SV=1 1 330 1.0E-44
sp|B0DK33|MDM10_LACBS Mitochondrial distribution and morphology protein 10 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MDM10 PE=3 SV=1 1 330 5.0E-44
sp|B8P366|MDM10_POSPM Mitochondrial distribution and morphology protein 10 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=MDM10 PE=3 SV=1 1 332 7.0E-44
sp|A5DCL4|MDM10_PICGU Mitochondrial distribution and morphology protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MDM10 PE=3 SV=3 1 455 4.0E-43
sp|C5FMP1|MDM10_ARTOC Mitochondrial distribution and morphology protein 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MDM10 PE=3 SV=2 1 332 5.0E-41
sp|P18409|MDM10_YEAST Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM10 PE=1 SV=5 1 363 1.0E-39
sp|B6K463|MDM10_SCHJY Mitochondrial distribution and morphology protein 10 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mdm10 PE=3 SV=1 1 355 2.0E-39
sp|A7A0F9|MDM10_YEAS7 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM10 PE=3 SV=1 1 363 2.0E-39
sp|B5VDL3|MDM10_YEAS6 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MDM10 PE=3 SV=1 1 332 7.0E-39
sp|B3LUU7|MDM10_YEAS1 Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MDM10 PE=3 SV=1 1 332 7.0E-39
sp|C4QWJ4|MDM10_PICPG Mitochondrial distribution and morphology protein 10 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MDM10 PE=3 SV=1 1 472 4.0E-38
sp|Q758T7|MDM10_ASHGO Mitochondrial distribution and morphology protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM10 PE=3 SV=2 1 460 9.0E-38
sp|Q6CKU5|MDM10_KLULA Mitochondrial distribution and morphology protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM10 PE=3 SV=1 1 452 1.0E-37
sp|C5E1U4|MDM10_ZYGRC Mitochondrial distribution and morphology protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MDM10 PE=3 SV=1 1 450 1.0E-34
sp|Q6FWV0|MDM10_CANGA Mitochondrial distribution and morphology protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDM10 PE=3 SV=1 1 472 1.0E-33
sp|A7TNL0|MDM10_VANPO Mitochondrial distribution and morphology protein 10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM10 PE=3 SV=1 1 472 1.0E-27
sp|Q4PEP6|MDM10_USTMA Mitochondrial distribution and morphology protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDM10 PE=3 SV=1 188 330 5.0E-17
sp|Q4PEP6|MDM10_USTMA Mitochondrial distribution and morphology protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDM10 PE=3 SV=1 1 174 1.0E-16
sp|Q0TWV0|MDM10_PHANO Mitochondrial distribution and morphology protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDM10 PE=3 SV=1 405 472 9.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0032865 ERMES complex Yes
GO:0007005 mitochondrion organization Yes
GO:0016043 cellular component organization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0071840 cellular component organization or biogenesis No
GO:0006996 organelle organization No
GO:0008150 biological_process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0005575 cellular_component No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2328
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3387 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5778
Ophiocordyceps camponoti-floridani Ophcf2|05969
Ophiocordyceps camponoti-rufipedis Ophun1|2979
Ophiocordyceps kimflemingae Ophio5|3442
Ophiocordyceps subramaniannii Hirsu2|3165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3387
MREFMDHVHSAFYEATGWRRDNSYAALNATSDALLNFATPRGLRLTLSSLASPNFATSYQLGSVGVVDGSMAYLF
SSVPLRVVLTSQSATVPLPELLRAYRPLSPLPPRPAAPQVAQRRRDLPAPTTSQSPTPLLLPTPSLLYGRLYMPL
SQLEALAVRRLSPALQVQLSAVSAAHLRDGGTLLGLAQYDLGKCAFEGLASSDGGLLGLRGVYNFGGDADLSSPS
RPQTPEATNALNPAGDRIYGRFTTGGEIYYGTLNKSGGISLGARFATLPAHRGTPLSATMTLNPLMGSVAASYAV
VAGRHCSLATRMEFNVLSYESAWTVGMELWRKPFSRLVAADKFGGGDDDDDDDDGSGGGPQARRFMFKERCWQAK
LEWRLDNEDEAPKPTELRLNNKAMPTETGKSDGLEAGASNDQEYAGVLKTRLDQNLRIGVLWEGRAKSLLFSLGS
NIDLKRLDKPFRTLGLEIQFSS*
Coding >OphauG2|3387
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGTCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGCGCTGCTCAACTTTGCCACGCCACGAGGCCTCCGTCTGACGCTCTCTTCGCTG
GCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGGTTGGCGTCGTCGATGGCTCCATGGCATACCTCTTT
TCGTCGGTGCCGCTGCGCGTCGTGCTGACATCGCAGTCAGCCACAGTGCCGCTGCCTGAGCTACTGCGCGCCTAC
CGCCCCTTGTCCCCGCTGCCGCCTCGCCCGGCTGCTCCCCAAGTCGCCCAACGACGCCGCGACTTGCCCGCACCT
ACAACGTCGCAGTCGCCGACGCCATTGCTGCTGCCGACGCCATCGCTGCTGTATGGGAGGCTCTACATGCCGCTG
TCGCAGCTCGAGGCTCTGGCCGTGAGACGTCTGTCGCCCGCTCTGCAAGTCCAGCTCAGCGCTGTGTCGGCCGCA
CACCTTCGCGACGGCGGCACTCTACTCGGCCTGGCACAGTATGACCTGGGCAAGTGTGCCTTTGAGGGCCTGGCC
TCGAGCGATGGCGGCCTGCTGGGACTACGTGGCGTGTACAACTTTGGTGGCGATGCCGACTTGTCGTCCCCCAGT
CGTCCCCAAACACCAGAGGCTACCAATGCCTTGAACCCTGCTGGCGACCGCATCTATGGACGCTTTACCACTGGC
GGCGAAATCTACTATGGTACTCTCAACAAGTCGGGCGGCATCAGCCTGGGCGCCAGGTTTGCTACGCTGCCGGCA
CATCGAGGAACGCCGCTATCCGCCACCATGACGCTCAATCCCCTCATGGGCAGCGTGGCGGCGAGCTATGCTGTC
GTGGCAGGAAGGCACTGCAGTCTGGCGACGCGCATGGAGTTCAATGTGCTGAGCTACGAGAGCGCCTGGACCGTG
GGCATGGAGCTCTGGCGCAAGCCTTTTAGTCGACTGGTCGCCGCAGACAAGTTTGGTGGCGGCGACGACGACGAC
GACGACGATGACGGCAGCGGCGGTGGTCCTCAAGCACGGCGCTTCATGTTCAAGGAACGTTGCTGGCAGGCCAAA
CTGGAATGGAGGCTCGACAATGAAGACGAGGCGCCCAAGCCCACAGAACTGAGATTGAACAACAAGGCCATGCCT
ACCGAGACGGGAAAGTCTGATGGACTAGAGGCTGGCGCCTCGAATGACCAAGAGTACGCTGGTGTCCTCAAGACG
AGACTAGACCAGAATCTACGCATTGGCGTGCTGTGGGAAGGGCGGGCAAAGTCGTTGCTCTTTAGTCTGGGTAGC
AACATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTCGGGCTAGAGATTCAATTTTCGTCGTGA
Transcript >OphauG2|3387
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGTCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGCGCTGCTCAACTTTGCCACGCCACGAGGCCTCCGTCTGACGCTCTCTTCGCTG
GCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGGTTGGCGTCGTCGATGGCTCCATGGCATACCTCTTT
TCGTCGGTGCCGCTGCGCGTCGTGCTGACATCGCAGTCAGCCACAGTGCCGCTGCCTGAGCTACTGCGCGCCTAC
CGCCCCTTGTCCCCGCTGCCGCCTCGCCCGGCTGCTCCCCAAGTCGCCCAACGACGCCGCGACTTGCCCGCACCT
ACAACGTCGCAGTCGCCGACGCCATTGCTGCTGCCGACGCCATCGCTGCTGTATGGGAGGCTCTACATGCCGCTG
TCGCAGCTCGAGGCTCTGGCCGTGAGACGTCTGTCGCCCGCTCTGCAAGTCCAGCTCAGCGCTGTGTCGGCCGCA
CACCTTCGCGACGGCGGCACTCTACTCGGCCTGGCACAGTATGACCTGGGCAAGTGTGCCTTTGAGGGCCTGGCC
TCGAGCGATGGCGGCCTGCTGGGACTACGTGGCGTGTACAACTTTGGTGGCGATGCCGACTTGTCGTCCCCCAGT
CGTCCCCAAACACCAGAGGCTACCAATGCCTTGAACCCTGCTGGCGACCGCATCTATGGACGCTTTACCACTGGC
GGCGAAATCTACTATGGTACTCTCAACAAGTCGGGCGGCATCAGCCTGGGCGCCAGGTTTGCTACGCTGCCGGCA
CATCGAGGAACGCCGCTATCCGCCACCATGACGCTCAATCCCCTCATGGGCAGCGTGGCGGCGAGCTATGCTGTC
GTGGCAGGAAGGCACTGCAGTCTGGCGACGCGCATGGAGTTCAATGTGCTGAGCTACGAGAGCGCCTGGACCGTG
GGCATGGAGCTCTGGCGCAAGCCTTTTAGTCGACTGGTCGCCGCAGACAAGTTTGGTGGCGGCGACGACGACGAC
GACGACGATGACGGCAGCGGCGGTGGTCCTCAAGCACGGCGCTTCATGTTCAAGGAACGTTGCTGGCAGGCCAAA
CTGGAATGGAGGCTCGACAATGAAGACGAGGCGCCCAAGCCCACAGAACTGAGATTGAACAACAAGGCCATGCCT
ACCGAGACGGGAAAGTCTGATGGACTAGAGGCTGGCGCCTCGAATGACCAAGAGTACGCTGGTGTCCTCAAGACG
AGACTAGACCAGAATCTACGCATTGGCGTGCTGTGGGAAGGGCGGGCAAAGTCGTTGCTCTTTAGTCTGGGTAGC
AACATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTCGGGCTAGAGATTCAATTTTCGTCGTGA
Gene >OphauG2|3387
ATGCGCGAGTTTATGGACCATGTCCACAGCGCCTTTTACGAGGCGACGGGCTGGCGTCGCGACAATTCCTATGCG
GCGCTCAATGCCACTTCGGACGGCACGTCTTTTTTTGTTTTTATTTTCCATTTCCATTTTGATGCAGCACCCCCT
CCTCTGCATCAAAAGCAAACCCCTGGCTGACCTTGGCCAGCGCTGCTCAACTTTGCCACGCCACGAGGCCTCCGT
CTGACGCTCTCTTCGCTGGCCAGCCCCAACTTTGCCACGTCGTACCAGCTGGGCTCGGTTGGCGTCGTCGATGGC
TCCATGGCATACCTCTTTTCGTCGGTGCCGCTGCGCGTCGTGCTGACATCGCAGTCAGCCACAGTGCCGCTGCCT
GAGCTACTGCGCGCCTACCGCCCCTTGTCCCCGCTGCCGCCTCGCCCGGCTGCTCCCCAAGTCGCCCAACGACGC
CGCGACTTGCCCGCACCTACAACGTCGCAGTCGCCGACGCCATTGCTGCTGCCGACGCCATCGCTGCTGTATGGG
AGGCTCTACATGCCGCTGTCGCAGCTCGAGGCTCTGGCCGTGAGACGTCTGTCGCCCGCTCTGCAAGTCCAGCTC
AGCGCTGTGTCGGCCGCACACCTTCGCGACGGCGGCACTCTACTCGGCCTGGCACAGTATGACCTGGGCAAGTGT
GCCTTTGAGGGCCTGGCCTCGAGCGATGGCGGCCTGCTGGGACTACGTGGCGTGTACAACTTTGGTGGCGATGCC
GACTTGTCGTCCCCCAGTCGTCCCCAAACACCAGAGGCTACCAATGCCTTGAACCCTGCTGGCGACCGCATCTAT
GGACGCTTTACCACTGGCGGCGAAATCTACTATGGTACTCTCAACAAGTCGGGCGGCATCAGCCTGGGCGCCAGG
TTTGCTACGCTGCCGGCACATCGAGGAACGCCGCTATCCGCCACCATGACGCTCAATCCCCTCATGGGCAGCGTG
GCGGCGAGCTATGCTGTCGTGGCAGGAAGGCACTGCAGTCTGGCGACGCGCATGGAGTTCAATGTGCTGAGCTAC
GAGAGCGCCTGGACCGTGGGCATGGAGCTCTGGCGCAAGCCTTTTAGTCGACTGGTCGCCGCAGACAAGTTTGGT
GGCGGCGACGACGACGACGACGACGATGACGGCAGCGGCGGTGGTCCTCAAGCACGGCGCTTCATGTTCAAGGAA
CGTTGCTGGCAGGCCAAACTGGAATGGAGGCTCGACAATGAAGACGAGGCGCCCAAGCCCACAGAACTGAGATTG
AACAACAAGGCCATGCCTACCGAGACGGGAAAGTCTGATGGACTAGAGGCTGGCGCCTCGAATGACCAAGAGTAC
GCTGGTGTCCTCAAGACGAGACTAGACCAGAATCTACGCATTGGCGTGCTGTGGGAAGGGCGGGCAAAGTCGTTG
CTCTTTAGTCTGGGTAGCAACATTGATTTGAAGAGGCTCGACAAGCCGTTTCGGACGCTCGGGCTAGAGATTCAA
TTTTCGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail